PRGDB00072075 (Os.15973)

From PRG Wiki
Jump to: navigation, search
Os.15973
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 44679206 (CR292640)
Gene Class Unknown
Domain Type
Gene Species Oryza sativa Japonica Group

Comment?

CR292640 Oryza sativa library (Han B) Oryza sativa cDNA clone y739g10p3, mRNA sequence

DNA Sequence

nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnatcttctctttttttttGGCAAGGTCATCTGAACATCCTGTTCAAAGATTTAGAATTCAAATGTTAGGTCTGCCTTCGGCGAGAGCATGATTAGGTACAGAGCACACTCATGTCACACATCACACTCTTCATTATCAACAGAGGAGAGAAATCGGTCCATCACTCAACAGAGAAGAGAGAAATCGATCCATGAGTGATGCGGATGGCAGACAGAAACTATGAACATGATACTCTAGTACTCCTACCATGGAAACTGTTCAGATTCATGATACGAGCCAGGAAAACAGATGCAAGATTATATTTCAGGTGCGCCAGGTCTGCAGCATCAAGAGAAGCAGGATGGGCTCTTCCGCAAATTACTCTTCTTTAGTCTCCAGCAATTTGGAATCGCAGGCCACGATCTTCACCTTGTTTATTGTCTCTGTAATCTCTTCGTTCTTGAAAATTGGATCTGTTAGGATGAAAGTCCACACATTGTCGCAGAACCTGTAGGTGTGCAGATGGCCCTTGACAGTAACCTTGCTCTTCACTTGATGTCCAAAGCGCTAGCATGGACTTGTCAATTGACGAGGATTGGATGGGAGTCGGGCAGAAGCGCAGGAGACAGTCGCCATAGATGGAGGTATACGAGGGACCCGGAAGGCGTAGGGATTGGCATAACAGCCGCTCTGATGATGAGAAGTTACGACGGGAGGAGGGGGATGAATAGTTAACAGGCCCGGGTGATGCAATGGCGACAATTACTTGCGTTTTTCTGTACTGACGTGCTATCGGAGTTCATACATGACGAGTAATGAGAAAGAGCAGAGCGACAGAAACTGAGGTTAGGCAAGATGGAGTGAGCGAGAATCGGGTGTGGACAGGGGNAGGAGGAGCGAGAGAGAGAAGGAGCAGGACCAACGAAGGAAGAGAAAGAACGAAGAGGATCATACAGCGTGAGAGACGAGACAGACAGTAGAGGGAAGAGAAGGAGGGAGACTAACAGAAATGAATGAGGGAGGATAA


Protein sequences

Name Description Sequence
Os.15973 translated coding region predicted by ESTScan from UniGene Os.15973

MATVSCASARLPSNPRQLTSPCXRFGHQVKSKVTVKGHLHTYRFCDNVWTFILTDPIFKNEEITETINKVKIVACDSKLLETKEEXFAEEPILLLLMLQTWRT

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10966
IPR003194
27-79 TRANSCRIPTION INITIATION FACTOR IIA SUBUNIT 2
Transcription initiation factor IIA, gamma subunit

HQVKSKVTVKGHLHTYRFCDNVWTFILTDPIFKNEEITETINKVKIVACDSKL

HMMPfam: PF02751
IPR015871
28-77 TFIIA_gamma_C
Transcription initiation factor IIA, gamma subunit

QVKSKVTVKGHLHTYRFCDNVWTFILTDPIFKNEEITETINKVKIVACDS

superfamily: SSF50784
IPR009088
28-78 Transcription factor IIA (TFIIA), beta-barrel domain
Transcription factor IIA, beta-barrel

QVKSKVTVKGHLHTYRFCDNVWTFILTDPIFKNEEITETINKVKIVACDSK

Gene3D: G3DSA:2.30.18.10
IPR009088
31-82 no description
Transcription factor IIA, beta-barrel

SKVTVKGHLHTYRFCDNVWTFILTDPIFKNEEITETINKVKIVACDSKLLET






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox