PRGDB00072172 (Os.21562)

From PRG Wiki
Jump to: navigation, search
Os.21562
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 22652527 (AF456245)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) NBS-LRR-like protein (YR5) mRNA, complete cds

DNA Sequence

CAAGGACCAAGCTGCAGGCAGCTGGCTCAAGAGCTCCGGGCGGGTCAAGGTCTCCTCCTCTCTCGTCGGCGACCTCCCTTGCGATTGATTCATCAGGGTTCTGCACATTGACCGTACAGCACCTGCGCTCCAGCCCTGTTCTCTGGTCTTCCAGCAGAACAAATGGCTGAGGCAGTGCTCCTTTCTGTCAAAAAGGTTGGCAACGTGTTAGCAGATGAAGCTGCCAACGCTGTCATTGCCAAGGTGTCTGAAAAGGTTACTAATTTGAAGGAGATGCCAGAGAAGGTCGAGGAAATAAGGAAGCAACTGACAATCATGAACAGTGTTATACTACAGATAGGCACCTCATACCTCACTGGTATAGTTGTAAAGAATTGGATTGCAGAGGTGAGAAAGTTAGCCTACCATGTTGAGGACGTAATGGACAAGTACTCATATCATGCTATTCAACTTGAGGAAGAAGGTTTCTTGAAGAAGTACTTCGTTAAAGGTTCTCATAAAGTCGTGGTATTTAGTGATATTGCTGAGGAGGTAGTCAAGTTAGAGAAGCAAATCCAGCAAGTTATAAAGCTTAAAGAGCAGTGGTTGCACCCTTCCCAGCTCAATCCCAACCAGCTTGCTGAGACTGGCAGACCACGGTCTCACGACAACTTCCCATATCTTGTCAAAGATGAAGATCTTGTGGGGATTGAAGACCACAAGAGATTGCTGGCTGGATGGTTGTACTCTGATGAGCCAGATAGAGCAGTGATAACAGTATCTGGTATAGGTGGGTTGGGAAAAACCACATTAGTCACAAATGTTTATGAGCGTGAAAAGGTCAACTTTGCTGCTCATGCATGGATTGTTGTCTCCCAGACCTACAATGTGGAGGCTCTATTAAGAAAGCTCCTTAGAAAGATTGGGTCTACTGAACTGTCACTTGATAGCTTGAACAATATGGATGCACATGACCTGAAAGAAGAAATTAATAAAAAGATTGAAGATAGCAAATGTTTGATTGTGCTGGATGATGTCTGGGACAAAAAAGTGTACTTTCAGATGCAAGATGCATTCCAGAATCTTCAAGCAACTCGAGTCATCATCACAACTCGAGAGAATGATGTTGCAGCCCTTGCTACCTCAACACGCCGTCTCAACCTCCAGCCTTTGAATGGCGCTGATGCATTTGAACTCTTCTGTAGAAGGGCTTTCTATAACAAGGGCCACAAATGCCCCAAGGAGCTAGAGAAGGTTGCTAATTCTATAGTGGATAGGTGTCATGGCCTACCACTAGCAATTGTAACGATAGGAAGCCTTCTGTCTTCAAGACCAGCAGCAGAATTTGTTTGGAATAAAATATACAAACAGCTTCGGACTGAGCTAGCAAACAATGATCATGTCCGAGCAATTCTAAATTTGAGCTACCATGACCTATCAGGAGACCTCAGAAATTGCTTCTTGTACTGTAGCTTGTTCCCTGAAGACTACACAATGACACGGGAGAGCCTTCTGAGGTTGTGGGTTGCAGAAGGCTTTGTGCTAGGCAAAGAAAAGAACACGCTAGAGGATGTCGCAGAGGGAAACCTTATGGAACTGATCCACCGGAATATGCTGGAAGTTGTGGACAATGATGAGATTGGCAGGGTAAACTCCTGTAAGATGCATGACATTGTGCGTGTATTGGCTCTTTCTATTGCTAAAGAGGAGAGGTTTGGTTCAGCCAATGATCTTGGCACAATGTTGCTTATGGATAAGGAAGTTCGTCGCTTGTCAACATGTGGATGGAGTGATGATACTGTATCAACAGTTAAATTCATGCGCCTTCGGACCCTGATCTCACTTTCGACAACCTCATTGCCCCTTGAGATGTTATCCTCAATTTTGTGTGGATCTAGCTACCTTACAGTTCTTGAGCTGCAAGACTCAGAGATTACTGAAGTGCCGACTTCTATTGGGAATATGTTTAATCTACGTTACATTGGCTTACGACGCACCAAAGTCAAATCACTTCCGGAGTCTATTGGAAAGTTATCTAACCTCCACACGCTTGACATCAAGCAAACCAAAATTGAGAAGCTACCACGAAGTATTGTTAAGATCAAGAAGCTAAGACACCTTATAGCCGATAGATACGTTGATGAGAGGCAGTCAGATTTCCGGTACTTTGTTGGAATGCATGCCCCTAAAGAACTTTCCAACTTGCAAGAGCTGCAGACTCTAGAAACTGTGGAGTCTAGCAAAGACCTGGCTGAGCAACTGAAGAAATTGATGCAACTAAGAAGTGTGTGGATTGACAACATAAGTTCTGCTGATTGTGCAAATATTTTCGCTTTTCTTTCCAGCTTGCTTCTTTCTGCAAAAGATGAAAATGAGGAACTCTGCTTCGAGGCTCTTAGGCCAAGGTCAACAGAACTCCACAGACTAATCATCAGAGGGCGATGGGCTAAGGGTACACTTGATTGCCCAATATTTCACGGGAACGGCACAAATCTTAAATATCTAGCTCTAAGTTGGTGTCATCTTGGTGAAGATCCACTAGGGATGCTCGCTTCGCATTTGCCGAACCTCACTTATTTGAGACTGAACAACATGCATAGTGCAAACATTTTGGTTCTTTCTCAGTCTTTTCCCCACCTGAAGACACTTGTCTTAAAGCACATGCCCAATGTGAACCAGCTAAAGATCATGGATGGGGCACTTCCATCCATTGAAGGTTTGTACGTTGTGTCACTCTCAAAGCTGGATATAGTCCCTGAGGGCATTGAGTCCCTTCGGACCCTGAAGAAGCTCTGGCTTCTGTACCTGCACAGGGACTTCAAAACTCAATGGCACAAAAACAGAATGCATCAGAAGATGCAGCATGTTCCAGAGATTCGTGTTTAGAACTTTAGATGCGGCTGGCTGGTGCCGTTTGTAGTTTTTTTCCCCCTCTGTTTGCAGCAGGTGTCGATTTCCGATGAGTTGCCTATCATTCCTAGCTTTTTTGCGTTCGCGGTGCCTCTGTACATTATGTGTAGTTTCATTTACTTTGATATTCATTGTATGTAAGAGCACATCCATTTTTTTATAAGACCTTATTTGCATGTACTGTTGCCAATATATTAATCTCTCTGTTTGGAGATaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Os.21562 translated coding region predicted by ESTScan from UniGene Os.21562

QGPSCRQLAQELRAGQGLLLSRRRPPLRLIHQGSAHXPYSTCAPALFSGLPAEQMAEAVLLSVKKVGNVLADEAANAVIAKVSEKVTNLKEMPEKVEEIRKQLTIMNSVILQIGTSYLTGIVVKNWIAEVRKLAYHVEDVMDKYSYHAIQLEEEGFLKKYFVKGSHKVVVFSDIAEEVVKLEKQIQQVIKLKEQWLHPSQLNPNQLAETGRPRSHDNFPYLVKDEDLVGIEDHKRLLAGWLYSDEPDRAVITVSGIGGLGKTTLVTNVYEREKVNFAAHAWIVVSQTYNVEALLRKLLRKIGSTELSLDSLNNMDAHDLKEEINKKIEDSKCLIVLDDVWDKKVYFQMQDAFQNLQATRVIITTRENDVAALATSTRRLNLQPLNGADAFELFCRRAFYNKGHKCPKELEKVANSIVDRCHGLPLAIVTIGSLLSSRPAAEFVWNKIYKQLRTELANNDHVRAILNLSYHDLSGDLRNCFLYCSLFPEDYTMTRESLLRLWVAEGFVLGKEKNTLEDVAEGNLMELIHRNMLEVVDNDEIGRVNSCKMHDIVRVLALSIAKEERFGSANDLGTMLLMDKEVRRLSTCGWSDDTVSTVKFMRLRTLISLSTTSLPLEMLSSILCGSSYLTVLELQDSEITEVPTSIGNMFNLRYIGLRRTKVKSLPESIGKLSNLHTLDIKQTKIEKLPRSIVKIKKLRHLIADRYVDERQSDFRYFVGMHAPKELSNLQELQTLETVESSKDLAEQLKKLMQLRSVWIDNISSADCANIFAFLSSLLLSAKDENEELCFEALRPRSTELHRLIIRGRWAKGTLDCPIFHGNGTNLKYLALSWCHLGEDPLGMLASHLPNLTYLRLNNMHSANILVLSQSFPHLKTLVLKHMPNVNQLKIMDGALPSIEGLYVVSLSKLDIVPEGIESLRTLKKLWLLYLHRDFKTQWHKNRMHQKMQHVPEIRV

Domains

Domain Start-End Description Sequence

Seg: seg
18-29 seg

LLLSRRRPPLRL

HMMPanther: PTHR23155:SF197
67-954 OS11G0227100 PROTEIN,OS11G0227100 PROTEIN

GNVLADEAANAVIAKVSEKVTNLKEMPEKVEEIRKQLTIMNSVILQIGTSYLTGIVVKNWIAEVRKLAYHVEDVMDKYSYHAIQLEEEGFLKKYFVKGSHKVVVFSDIAEEVVKLEKQIQQVIKLKEQWLHPSQLNPNQLAETGRPRSHDNFPYLVKDEDLVGIEDHKRLLAGWLYSDEPDRAVITVSGIGGLGKTTLVTNVYEREKVNFAAHAWIVVSQTYNVEALLRKLLRKIGSTELSLDSLNNMDAHDLKEEINKKIEDSKCLIVLDDVWDKKVYFQMQDAFQNLQATRVIITTRENDVAALATSTRRLNLQPLNGADAFELFCRRAFYNKGHKCPKELEKVANSIVDRCHGLPLAIVTIGSLLSSRPAAEFVWNKIYKQLRTELANNDHVRAILNLSYHDLSGDLRNCFLYCSLFPEDYTMTRESLLRLWVAEGFVLGKEKNTLEDVAEGNLMELIHRNMLEVVDNDEIGRVNSCKMHDIVRVLALSIAKEERFGSANDLGTMLLMDKEVRRLSTCGWSDDTVSTVKFMRLRTLISLSTTSLPLEMLSSILCGSSYLTVLELQDSEITEVPTSIGNMFNLRYIGLRRTKVKSLPESIGKLSNLHTLDIKQTKIEKLPRSIVKIKKLRHLIADRYVDERQSDFRYFVGMHAPKELSNLQELQTLETVESSKDLAEQLKKLMQLRSVWIDNISSADCANIFAFLSSLLLSAKDENEELCFEALRPRSTELHRLIIRGRWAKGTLDCPIFHGNGTNLKYLALSWCHLGEDPLGMLASHLPNLTYLRLNNMHSANILVLSQSFPHLKTLVLKHMPNVNQLKIMDGALPSIEGLYVVSLSKLDIVPEGIESLRTLKKLWLLYLHRDFKTQWHKNRMHQKMQHVPEIRV

HMMPanther: PTHR23155
67-954 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GNVLADEAANAVIAKVSEKVTNLKEMPEKVEEIRKQLTIMNSVILQIGTSYLTGIVVKNWIAEVRKLAYHVEDVMDKYSYHAIQLEEEGFLKKYFVKGSHKVVVFSDIAEEVVKLEKQIQQVIKLKEQWLHPSQLNPNQLAETGRPRSHDNFPYLVKDEDLVGIEDHKRLLAGWLYSDEPDRAVITVSGIGGLGKTTLVTNVYEREKVNFAAHAWIVVSQTYNVEALLRKLLRKIGSTELSLDSLNNMDAHDLKEEINKKIEDSKCLIVLDDVWDKKVYFQMQDAFQNLQATRVIITTRENDVAALATSTRRLNLQPLNGADAFELFCRRAFYNKGHKCPKELEKVANSIVDRCHGLPLAIVTIGSLLSSRPAAEFVWNKIYKQLRTELANNDHVRAILNLSYHDLSGDLRNCFLYCSLFPEDYTMTRESLLRLWVAEGFVLGKEKNTLEDVAEGNLMELIHRNMLEVVDNDEIGRVNSCKMHDIVRVLALSIAKEERFGSANDLGTMLLMDKEVRRLSTCGWSDDTVSTVKFMRLRTLISLSTTSLPLEMLSSILCGSSYLTVLELQDSEITEVPTSIGNMFNLRYIGLRRTKVKSLPESIGKLSNLHTLDIKQTKIEKLPRSIVKIKKLRHLIADRYVDERQSDFRYFVGMHAPKELSNLQELQTLETVESSKDLAEQLKKLMQLRSVWIDNISSADCANIFAFLSSLLLSAKDENEELCFEALRPRSTELHRLIIRGRWAKGTLDCPIFHGNGTNLKYLALSWCHLGEDPLGMLASHLPNLTYLRLNNMHSANILVLSQSFPHLKTLVLKHMPNVNQLKIMDGALPSIEGLYVVSLSKLDIVPEGIESLRTLKKLWLLYLHRDFKTQWHKNRMHQKMQHVPEIRV

superfamily: SSF52540
210-458 P-loop containing nucleoside triphosphate hydrolases

GRPRSHDNFPYLVKDEDLVGIEDHKRLLAGWLYSDEPDRAVITVSGIGGLGKTTLVTNVYEREKVNFAAHAWIVVSQTYNVEALLRKLLRKIGSTELSLDSLNNMDAHDLKEEINKKIEDSKCLIVLDDVWDKKVYFQMQDAFQNLQATRVIITTRENDVAALATSTRRLNLQPLNGADAFELFCRRAFYNKGHKCPKELEKVANSIVDRCHGLPLAIVTIGSLLSSRPAAEFVWNKIYKQLRTELANN

Gene3D: G3DSA:3.40.50.300
222-368 no description

VKDEDLVGIEDHKRLLAGWLYSDEPDRAVITVSGIGGLGKTTLVTNVYEREKVNFAAHAWIVVSQTYNVEALLRKLLRKIGSTELSLDSLNNMDAHDLKEEINKKIEDSKCLIVLDDVWDKKVYFQMQDAFQNLQATRVIITTREND

HMMPfam: PF00931
IPR002182
231-507 NB-ARC,NBS
NB-ARC

EDHKRLLAGWLYSDEPDRAVITVSGIGGLGKTTLVTNVYEREKVNFAAHAWIVVSQTYNVEALLRKLLRKIGSTELSLDSLNNMDAHDLKEEINKKIEDSKCLIVLDDVWDKKVYFQMQDAFQNLQATRVIITTRENDVAALATSTRRLNLQPLNGADAFELFCRRAFYNKGHKCPKELEKVANSIVDRCHGLPLAIVTIGSLLSSRPAAEFVWNKIYKQLRTELANNDHVRAILNLSYHDLSGDLRNCFLYCSLFPEDYTMTRESLLRLWVAEGFV

FPrintScan: PR00364
IPR000767
250-265 DISEASERSIST
Disease resistance protein

VITVSGIGGLGKTTLV

FPrintScan: PR00364
IPR000767
326-340 DISEASERSIST
Disease resistance protein

KIEDSKCLIVLDDVW

FPrintScan: PR00364
IPR000767
420-434 DISEASERSIST
Disease resistance protein

CHGLPLAIVTIGSLL

superfamily: SSF52058
547-926 L domain-like,LRR

KMHDIVRVLALSIAKEERFGSANDLGTMLLMDKEVRRLSTCGWSDDTVSTVKFMRLRTLISLSTTSLPLEMLSSILCGSSYLTVLELQDSEITEVPTSIGNMFNLRYIGLRRTKVKSLPESIGKLSNLHTLDIKQTKIEKLPRSIVKIKKLRHLIADRYVDERQSDFRYFVGMHAPKELSNLQELQTLETVESSKDLAEQLKKLMQLRSVWIDNISSADCANIFAFLSSLLLSAKDENEELCFEALRPRSTELHRLIIRGRWAKGTLDCPIFHGNGTNLKYLALSWCHLGEDPLGMLASHLPNLTYLRLNNMHSANILVLSQSFPHLKTLVLKHMPNVNQLKIMDGALPSIEGLYVVSLSKLDIVPEGIESLRTLKKLWL

Gene3D: G3DSA:3.80.10.10
579-765 no description

KEVRRLSTCGWSDDTVSTVKFMRLRTLISLSTTSLPLEMLSSILCGSSYLTVLELQDSEITEVPTSIGNMFNLRYIGLRRTKVKSLPESIGKLSNLHTLDIKQTKIEKLPRSIVKIKKLRHLIADRYVDERQSDFRYFVGMHAPKELSNLQELQTLETVESSKDLAEQLKKLMQLRSVWIDNISSAD

Seg: seg
602-615 seg

LRTLISLSTTSLPL

HMMPfam: PF12799
650-688 LRR_4,Leucine Rich repeats (2 copies)

NLRYIGLRRTKVKSLPESIGKLSNLHTLDIKQTKIEKLP

FPrintScan: PR00364
IPR000767
669-685 DISEASERSIST
Disease resistance protein

GKLSNLHTLDIKQTKIE

Seg: seg
773-779 seg

LSSLLLS

Gene3D: G3DSA:3.80.10.10
773-930 no description

LSSLLLSAKDENEELCFEALRPRSTELHRLIIRGRWAKGTLDCPIFHGNGTNLKYLALSWCHLGEDPLGMLASHLPNLTYLRLNNMHSANILVLSQSFPHLKTLVLKHMPNVNQLKIMDGALPSIEGLYVVSLSKLDIVPEGIESLRTLKKLWLLYLH

Seg: seg
918-929 seg

LRTLKKLWLLYL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox