PRGDB00073113 (Os.80649)

From PRG Wiki
Jump to: navigation, search
Os.80649
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 297595966 (NM_001048375)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group Os01g0116000 (Os01g0116000) mRNA, complete cds

DNA Sequence

ATGGTGATTCCTGGTCCGTTCTTCCGTCGCTCGACTGCCCTGCAAGTTTTCTCTGTCCTGTGTGTGCTTCGATTTGTCGTCCCAGATCCGGATATAGAATGGCCTTTAATTCATGGAATACCTGCATGCCCTCCGTTCACCTGCGGCCATCTTAGCAAAGTCGCGTCTCCTTTCCACCGGCGAGGCTACGAGTGCGGTGTTGCATCGTATGAGCTGACTTGCACCGATGACAAGGCTACAATTCAGATCGACAACGGAACATACTTTGTGACAGGCATCGACTACAGTGATTCCACCTTCTGGGTTGTCGACGCCAACATCTCGGATTCACGTAACAATTGCCCTCTTCCTCGCTGGAAACGCATTCCTTATTACTATGATGATGTTAGTAGTGACGACGAAGAATCATCGCCATACAACATCCAAGTCGAATTGGACCCTGCTTCACGTTGGTGGTCTTTCTTTGTCAACTGTTCCAAGGAAATAAACAACAATGTTATGTACAGTCCTGTTGCTTGCATGGGCACCAGCAGCTCCTTCGTTTATGTCTTGACTGGCAGATTGTCCTGTTACATTGAAAACCTCGAGCCTTCCTGTGGTTACCTAGCCATGACTCCTTTGGATGGTATGGGTCGTGTAGCACCAGCAGTTGATAGCTTAAGTTATGAAGACGTAGTAAAATTCATGAGGAAAGGATTCCGCGTCCAATTTCCTTTCAGACACCATAGAAATCGAAGCTTCAAGGATTGCCTAATGGAGTCGATTCCCAAATCGACTGGTATAGGCAAACTTTCAGATTGGTTTAGTCTTTCGGTGACTGAAAATTTCATGGATTGCGCAACTGCTAAAATTCCATCGCCATACAATATACTCTTGGGCATAATATTGTATGCCTTGATGTTCTGGACGATGCTTGCACGTACGTATCTGTTGGCACCCTTGGTTGTATTGATTTTCCTTGCACAAAAGTACTTGAAAAGAATGATAACAATTGATGCAGTCGAGAAATTTCTCCGAATGCAACAAATGCTCGGTCCGACAAGGTATGCCTACACCGACATTATCGCAATCACAGGGCATTTCAGAGAAAAGTTGGGCCAAGGAGGCTACGGTTCTGTATACAAGGGTGTGCTGCTCCCGGGTGATCTCCATGTGGCTATCAAGATACTGAATGGCTACTCTAATTGCAACGGCGAAGAATTCATCAGTGAAGTTGCCACCATTGGTAGGATTCACCATGTTAATGTTGTGCGTTTGGTGGGGTTCTGCTCCGAGGAAATGAGAAGGGCCTTGGTTTACGAGTACATGCCTAGGGGATCTCTAGACAAACACATCTTCTCATCTGAGAGAAGATTCTCATGGGACAAGCTCAATGAGATTGCTCTAGGCATTGCTAGGGGGATCAACTACCTGCACCAAGGGTGTGATATGCAGATTCTACACTTTGACATCAAGCCACACAACATCCTTCTTGATGATAACTTTGTTCCAAAAGTTGCTGATTTCGGCCTCGCTAAACTGTACCCAAGGGACAAGAGCTTTGTGTCAGATAGGGCTTTACGAGGAACAGTGGGTTATATGGCTCCTGAGATGGTTTCCCGGAGCTTTGGCATCATATCTGGCAAGTCTGATGTTTACAGTTTTGGAATGTTGCTGCTTGAGATGGTCGGAGGACGAAGGAATGCAGATCCAAATGCAGATTCCAGTGCAAGTAAGGCATACTACCCATCATGGGTTTATGATAAGCTAATAGCAGATCAACAAGTTGATGAGATATCCAACTTTGCCAACATGCATGAGCTAGAGAGGAAGTTGTGCCTTGTTGGGCTGTGGTGCATTCAGATGAAATCACACGATCGGCCGACGATGAGTGAGGCAATAGAGATGCTCGAAGGGGGTGTGGATGCGCTGCAAGTGCCTCTGAGACCATTTTTCTGCGATGGGGATGGCATGCCACCTCCACAAGTCATGGATTCTTACTTTCACTCCTCCGATCTTTCTGCAATTTCAGAAGAGGACGATGGAATAGCTGAATTAGCCAGTAGTTAG


Protein sequences

Name Description Sequence
Os.80649 translated coding region predicted by ESTScan from UniGene Os.80649

MVIPGPFFRRSTALQVFSVLCVLRFVVPDPDIEWPLIHGIPACPPFTCGHLSKVASPFHRRGYECGVASYELTCTDDKATIQIDNGTYFVTGIDYSDSTFWVVDANISDSRNNCPLPRWKRIPYYYDDVSSDDEESSPYNIQVELDPASRWWSFFVNCSKEINNNVMYSPVACMGTSSSFVYVLTGRLSCYIENLEPSCGYLAMTPLDGMGRVAPAVDSLSYEDVVKFMRKGFRVQFPFRHHRNRSFKDCLMESIPKSTGIGKLSDWFSLSVTENFMDCATAKIPSPYNILLGIILYALMFWTMLARTYLLAPLVVLIFLAQKYLKRMITIDAVEKFLRMQQMLGPTRYAYTDIIAITGHFREKLGQGGYGSVYKGVLLPGDLHVAIKILNGYSNCNGEEFISEVATIGRIHHVNVVRLVGFCSEEMRRALVYEYMPRGSLDKHIFSSERRFSWDKLNEIALGIARGINYLHQGCDMQILHFDIKPHNILLDDNFVPKVADFGLAKLYPRDKSFVSDRALRGTVGYMAPEMVSRSFGIISGKSDVYSFGMLLLEMVGGRRNADPNADSSASKAYYPSWVYDKLIADQQVDEISNFANMHELERKLCLVGLWCIQMKSHDRPTMSEAIEMLEGGVDALQVPLRPFFCDGDGMPPPQVMDSYFHSSDLSAISEEDDGIAELASS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF441
297-674 PTHR24420:SF441,SUBFAMILY NOT NAMED

YALMFWTMLARTYLLAPLVVLIFLAQKYLKRMITIDAVEKFLRMQQMLGPTRYAYTDIIAITGHFREKLGQGGYGSVYKGVLLPGDLHVAIKILNGYSNCNGEEFISEVATIGRIHHVNVVRLVGFCSEEMRRALVYEYMPRGSLDKHIFSSERRFSWDKLNEIALGIARGINYLHQGCDMQILHFDIKPHNILLDDNFVPKVADFGLAKLYPRDKSFVSDRALRGTVGYMAPEMVSRSFGIISGKSDVYSFGMLLLEMVGGRRNADPNADSSASKAYYPSWVYDKLIADQQVDEISNFANMHELERKLCLVGLWCIQMKSHDRPTMSEAIEMLEGGVDALQVPLRPFFCDGDGMPPPQVMDSYFHSSDLSAISEEDD

HMMPanther: PTHR24420
297-674 PTHR24420,FAMILY NOT NAMED

YALMFWTMLARTYLLAPLVVLIFLAQKYLKRMITIDAVEKFLRMQQMLGPTRYAYTDIIAITGHFREKLGQGGYGSVYKGVLLPGDLHVAIKILNGYSNCNGEEFISEVATIGRIHHVNVVRLVGFCSEEMRRALVYEYMPRGSLDKHIFSSERRFSWDKLNEIALGIARGINYLHQGCDMQILHFDIKPHNILLDDNFVPKVADFGLAKLYPRDKSFVSDRALRGTVGYMAPEMVSRSFGIISGKSDVYSFGMLLLEMVGGRRNADPNADSSASKAYYPSWVYDKLIADQQVDEISNFANMHELERKLCLVGLWCIQMKSHDRPTMSEAIEMLEGGVDALQVPLRPFFCDGDGMPPPQVMDSYFHSSDLSAISEEDD

superfamily: SSF56112
IPR011009
331-630 Kinase_like
Protein kinase-like domain

IDAVEKFLRMQQMLGPTRYAYTDIIAITGHFREKLGQGGYGSVYKGVLLPGDLHVAIKILNGYSNCNGEEFISEVATIGRIHHVNVVRLVGFCSEEMRRALVYEYMPRGSLDKHIFSSERRFSWDKLNEIALGIARGINYLHQGCDMQILHFDIKPHNILLDDNFVPKVADFGLAKLYPRDKSFVSDRALRGTVGYMAPEMVSRSFGIISGKSDVYSFGMLLLEMVGGRRNADPNADSSASKAYYPSWVYDKLIADQQVDEISNFANMHELERKLCLVGLWCIQMKSHDRPTMSEAIEML

Gene3D: G3DSA:3.30.200.20
346-422 G3DSA:3.30.200.20

PTRYAYTDIIAITGHFREKLGQGGYGSVYKGVLLPGDLHVAIKILNGYSNCNGEEFISEVATIGRIHHVNVVRLVGF

ProfileScan: PS50011
IPR000719
359-645 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

GHFREKLGQGGYGSVYKGVLLPGDLHVAIKILNGYSNCNGEEFISEVATIGRIHHVNVVRLVGFCSEEMRRALVYEYMPRGSLDKHIFSSERRFSWDKLNEIALGIARGINYLHQGCDMQILHFDIKPHNILLDDNFVPKVADFGLAKLYPRDKSFVSDRALRGTVGYMAPEMVSRSFGIISGKSDVYSFGMLLLEMVGGRRNADPNADSSASKAYYPSWVYDKLIADQQVDEISNFANMHELERKLCLVGLWCIQMKSHDRPTMSEAIEMLEGGVDALQVPLRPFF

HMMPfam: PF00069
IPR017442
361-628 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

FREKLGQGGYGSVYKGVLLPGDLHVAIKILNGYSNCNGEEFISEVATIGRIHHVNVVRLVGFCSEEMRRALVYEYMPRGSLDKHIFSSERRFSWDKLNEIALGIARGINYLHQGCDMQILHFDIKPHNILLDDNFVPKVADFGLAKLYPRDKSFVSDRALRGTVGYMAPEMVSRSFGIISGKSDVYSFGMLLLEMVGGRRNADPNADSSASKAYYPSWVYDKLIADQQVDEISNFANMHELERKLCLVGLWCIQMKSHDRPTMSEAIE

PatternScan: PS00107
IPR017441
365-388 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGGYGSVYKGVLLPGDLHVAIK

Gene3D: G3DSA:1.10.510.10
423-629 G3DSA:1.10.510.10

CSEEMRRALVYEYMPRGSLDKHIFSSERRFSWDKLNEIALGIARGINYLHQGCDMQILHFDIKPHNILLDDNFVPKVADFGLAKLYPRDKSFVSDRALRGTVGYMAPEMVSRSFGIISGKSDVYSFGMLLLEMVGGRRNADPNADSSASKAYYPSWVYDKLIADQQVDEISNFANMHELERKLCLVGLWCIQMKSHDRPTMSEAIEM

PatternScan: PS00108
IPR008271
479-491 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

ILHFDIKPHNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox