PRGDB00073122 (Os.80724)

From PRG Wiki
Jump to: navigation, search
Os.80724
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 297595952 (NM_001048364)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group Os01g0114400 (Os01g0114400) mRNA, complete cds

DNA Sequence

ATGGAAGCAGCTGCTTTGTCGACCGTCCTGTATGTGCTCGCACTTGTGGTAGCGGATGCTGATCATCACGTCGTCCGTGTCCAAGGACGACGGCATCAGTGCCAACCTTTCTCCTGCGGCCATCTCCAAAACGTATCGTATCCTTTTCGCCGGCGAGGCGACCCTCGCAGTCGCAGGTGCGGCTTCCGGTCGTACGAGCTAGACTGCAGCAGCGATGATGGCAAGGCCACCATTCGGATCAACACAGGGAAATACTATGTGAGTAGCATCAACTACACTGCTTCCATCTTTTGGGTCGTCGACGCCAACCTGCAGGATGATGCAAACAGCAGCTGCCCTCTTCCTCGCTCGGACCAGCTGCCTTACGTTGGTCTGGGTATCCCAGGATCACACGACAGCTGGGACTTGGGCCTTGATGATATGATTACTTGGGTTGGCTTTGTCAATTGTTCGCAGGAACTAATTACGAACAGTAGTAGCAAATACCTGTACGTGTACCATCCCGTGGATTGCCTGACCACGGCTTTGTCCTTCGTTTATTATATGCTCCCATTTTTTGGTTCTTTAGTACCATCTGTCGAAGACATCGAACCTTCTTGTGGATACTTGGCCATGACTCCTATCGGCGGTGGCTGGAACTCCGTTAATCTGCCCGAATACACTAGTTATGCAGAGGTTGTAAAATCCATGAGGGGTGGATTTGCCGTCAAATTTCCAACACCTTGGCTTAATTGGTTTGGTCTCATCAAAAAATGCCTCAACAAGTCTGTTAGTCATAGGACAATGTCTACTAATGGGGGCTTAGAACATCTTGATTCACTCTTTGCTGCAAACTCCCTGTTGCCCATTCCTCCTACCTCGCCGCCGTTCGCCGGAACCCGTCGAACTTCGTCCGCCGTCCAATTGCCCCGCGATCTCCTCTGTCTTGGTCAAAGCTACATGGCAGGACTAGTCGTCCGCCGTGGGCAAGGACCTTCAGCGGCTTGGCGAAGAGGAGAAGGGCCACCCTTGGTCGCTGGAGGGGGAGGAGATGTCGATCGCGCTGGAGATGATGGAGGCGGAGAGGGAGATGGACAAGCGACGAAGTCGACGATGGATGGGGTCAGGCGCTTGAGAATGGCGAAGGTTTGTGTTCGCACCGTTGGCCGTGATGATTTTTCTTACTCGCAAGGCCAAGGAGGATATGGGTCTGTGTACAAGGGTGTGTTTCTCCCGGGTGATGTTCATGTCGCCATCAAGATGTTGGATGGCAACTCCAATTGCAATGGAGAAGACTTCATCAGTGAAGTTGCCACCATAGGCAGGATCCATCACATCAACGTGGTGCGTCTTGTGGGGTTCTGCTCCGAAGAAATGAGAAGGGCATTGGTTTACGAATACATGCCTAGAGGATCTCTAAACAAGTATATCTTCTCATCCGAGAGAAGCTTCTCTTGGGACAAGCTCAATGAGATTGCTCTAGGCATTGCTAGAGGGATCAACTACCTGCATCAGGGGTGCGAGATGCAGATTCTACACTTTGATATCAAGCCAGACAACATCCTTCTTGATGATAACTTTGTTTCAAAGGTTGCTGATTTCGGCCTCGCAAAACTGTACCCAAGGGAGAAGAGCTTTGTGTCAGATAGGGCTTTACGGGGAACAGTAGGTTATATGGCTCCTGAGATGATGAAATCACACGATCGCCCGACGATGAGCGAGGCAATAGAGATGCTCGAAGGGGATGTGGATGCGTTGCAAGTGCCTCTGAGACCATTTTTCTGCGATGGGGATGGCATTGGCAATGGCATGCCACCTCCACAAGTCATGGATTCTTACTTTCACTCCTCCGAGCTTACTGCAATCTCAGAAGAGGACGATGGAATAGCTGAATTAGCCAGTAGCTAG


Protein sequences

Name Description Sequence
Os.80724 translated coding region predicted by ESTScan from UniGene Os.80724

MEAAALSTVLYVLALVVADADHHVVRVQGRRHQCQPFSCGHLQNVSYPFRRRGDPRSRRCGFRSYELDCSSDDGKATIRINTGKYYVSSINYTASIFWVVDANLQDDANSSCPLPRSDQLPYVGLGIPGSHDSWDLGLDDMITWVGFVNCSQELITNSSSKYLYVYHPVDCLTTALSFVYYMLPFFGSLVPSVEDIEPSCGYLAMTPIGGGWNSVNLPEYTSYAEVVKSMRGGFAVKFPTPWLNWFGLIKKCLNKSVSHRTMSTNGGLEHLDSLFAANSLLPIPPTSPPFAGTRRTSSAVQLPRDLLCLGQSYMAGLVVRRGQGPSAAWRRGEGPPLVAGGGGDVDRAGDDGGGEGDGQATKSTMDGVRRLRMAKVCVRTVGRDDFSYSQGQGGYGSVYKGVFLPGDVHVAIKMLDGNSNCNGEDFISEVATIGRIHHINVVRLVGFCSEEMRRALVYEYMPRGSLNKYIFSSERSFSWDKLNEIALGIARGINYLHQGCEMQILHFDIKPDNILLDDNFVSKVADFGLAKLYPREKSFVSDRALRGTVGYMAPEMMKSHDRPTMSEAIEMLEGDVDALQVPLRPFFCDGDGIGNGMPPPQVMDSYFHSSELTAISEEDDGIAELASS

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
356-572 Kinase_like
Protein kinase-like domain

GDGQATKSTMDGVRRLRMAKVCVRTVGRDDFSYSQGQGGYGSVYKGVFLPGDVHVAIKMLDGNSNCNGEDFISEVATIGRIHHINVVRLVGFCSEEMRRALVYEYMPRGSLNKYIFSSERSFSWDKLNEIALGIARGINYLHQGCEMQILHFDIKPDNILLDDNFVSKVADFGLAKLYPREKSFVSDRALRGTVGYMAPEMMKSHDRPTMSEAIEML

ProfileScan: PS50011
IPR000719
384-628 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

DDFSYSQGQGGYGSVYKGVFLPGDVHVAIKMLDGNSNCNGEDFISEVATIGRIHHINVVRLVGFCSEEMRRALVYEYMPRGSLNKYIFSSERSFSWDKLNEIALGIARGINYLHQGCEMQILHFDIKPDNILLDDNFVSKVADFGLAKLYPREKSFVSDRALRGTVGYMAPEMMKSHDRPTMSEAIEMLEGDVDALQVPLRPFFCDGDGIGNGMPPPQVMDSYFHSSELTAISEEDDGIAELASS

HMMPanther: PTHR24420:SF441
391-620 PTHR24420:SF441,SUBFAMILY NOT NAMED

GQGGYGSVYKGVFLPGDVHVAIKMLDGNSNCNGEDFISEVATIGRIHHINVVRLVGFCSEEMRRALVYEYMPRGSLNKYIFSSERSFSWDKLNEIALGIARGINYLHQGCEMQILHFDIKPDNILLDDNFVSKVADFGLAKLYPREKSFVSDRALRGTVGYMAPEMMKSHDRPTMSEAIEMLEGDVDALQVPLRPFFCDGDGIGNGMPPPQVMDSYFHSSELTAISEEDD

HMMPanther: PTHR24420
391-620 PTHR24420,FAMILY NOT NAMED

GQGGYGSVYKGVFLPGDVHVAIKMLDGNSNCNGEDFISEVATIGRIHHINVVRLVGFCSEEMRRALVYEYMPRGSLNKYIFSSERSFSWDKLNEIALGIARGINYLHQGCEMQILHFDIKPDNILLDDNFVSKVADFGLAKLYPREKSFVSDRALRGTVGYMAPEMMKSHDRPTMSEAIEMLEGDVDALQVPLRPFFCDGDGIGNGMPPPQVMDSYFHSSELTAISEEDD

Gene3D: G3DSA:3.30.200.20
391-448 G3DSA:3.30.200.20

GQGGYGSVYKGVFLPGDVHVAIKMLDGNSNCNGEDFISEVATIGRIHHINVVRLVGFC

HMMPfam: PF00069
IPR017442
391-560 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

GQGGYGSVYKGVFLPGDVHVAIKMLDGNSNCNGEDFISEVATIGRIHHINVVRLVGFCSEEMRRALVYEYMPRGSLNKYIFSSERSFSWDKLNEIALGIARGINYLHQGCEMQILHFDIKPDNILLDDNFVSKVADFGLAKLYPREKSFVSDRALRGTVGYMAPEMMKSH

Gene3D: G3DSA:1.10.510.10
449-559 G3DSA:1.10.510.10

SEEMRRALVYEYMPRGSLNKYIFSSERSFSWDKLNEIALGIARGINYLHQGCEMQILHFDIKPDNILLDDNFVSKVADFGLAKLYPREKSFVSDRALRGTVGYMAPEMMKS

PatternScan: PS00108
IPR008271
504-516 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

ILHFDIKPDNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox