PRGDB00073132 (Os.81769)

From PRG Wiki
Jump to: navigation, search
Os.81769
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 22652531 (AF456247)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) NBS-LRR-like protein (YR48) mRNA, complete cds

DNA Sequence

GGGGTCAATACTAGAGATATAACCAAGTTGAGTCCCCCAGCATCCTCACCTGCTGTTCCGATTCACATCCCGGCAGATTGTACACTAATTTTAGAGAAGAGGCATTGCTGCCCAGCTTTATACTGAAAGCATAACAGATTGTACACTAATAGACTATGCCAATCGGAGAAGCTGTGCTGTCCGCGTTCATGCAGGCGCTTTTCGAGAAAGCGGTGGCCGCTGCTTCCAGCGAGCTGAAATTCCCTCAAAACATAGCTGTGGAGCTGCAGAATCTATCAAGCAGTCTGTCGACAATTCTGGCTCACGTTGAAGATGCAGAGGAGCGGCAGCTGAAAGATCAGGCGGCAAGAAGCTGGCTTTCCAGGCTGAAGGACGTCGCCTATGAGATGGATGACCTGCTTGATGAGCATGCTGCTGAAGTCCTCCGATCCAAACTTGCAGGCCCATCCAACTATCACCATCTGAAGGTTAGAATCTGCTTCTGCTGCATTTGGTTGAAAAATGGGTTATTTAACAGAGATTTAGTAAAACAAATAATGCGGATTGAGGGGAAGATCGATAGGCTTATTAAAGACAGACATATTGTCGATCCGATCATGAGGTTTAACAGGGAAGAGATAAGAGAGAGGCCCAAGACCAGTTCGTTAATTGACGACTCGAGTGTGTATGGTAGAGAAGAAGATAAAGAGGTCATTGTAAACATGTTACTCACCACGAATAACTCAAACCATGTCAACCTTTCTATTCTTCCCATAGTGGGTATGGGAGGAGTAGGGAAGACAACTTTAACACAGCTCGTCTACAATGATGTGAGAGTAAAGAAGCATTTCCAGTTAAGAATGTGGCTGTGTGTTTCTGAAAACTTTGATGAGGCCAAACTTACCAAGGAAACGATAGAATCAGTTGCGAGCGGATTATCATCCGCCACAACAAACATGAACTTGCTTCAAGAAGACCTCTCAAACAAGCTGAAAGGCAAAAGGTTTCTTCTAGTATTGGATGATGTATGGAATGAGGATCCTGATAGATGGGATAGATACCGATGTGCTCTAGTTGCTGGTGCAAAAGGAAGTAAAATTATGGTGACTACTCGAAATGAAAATGTTGGGAAATTAGTGGGCGGGTTGACTCCTTACTATCTAAAACAGTTATCATACAATGATTGCTGGCATTTATTCAGAAGCTATGCATTTGCAGATGGTGACTCCAGTGCACACCCAAATTTGGAAATGATCGGCAAGGAAATTGTCCATAAGTTGAAAGGCCTACCATTAGCTGCAAGAGCTTTAGGTAGCTTATTATGTGCTAAGGACAACGAGGATGACTGGAAAAATATCCTAGAAAGTGAAATATGGGAATTGCCATCAGACAAGAATAATATCTTACCAGCTCTGAGACTGAGTTACAATCATCTTCCACCCATATTGAAGCGATGCTTTGCATTCTGCTCGGTCTTTCACAAAGACTATGTGTTTGAGAAAGACATATTGGTCCAGATCTGGATGGCAGTTGGGTACATCCAGCCTCAAGGGCGGAGAAGGATGGAAGAGATTGGGAATAACTATTTTGATGAATTACTGAGCAGATCCTTCTTCCAAAAACACAAGGATGGATACGTGATGCATGATGCCATGCATGACCTAGCGCAGTCTGTCTCCATTGACGAATGCATGAGACTGGATAATCTTCCAAACAATAGCACCACAGAAAGAAATGCCAGGCACCTATCATTCTCTTGTGACAATAAAAGTCAAACTACATTTGAAGCTTTTCGTGGATTTAATAGAGCACGGAGCCTTCTACTGCTGAATGGATATAAATCAAAGACAAGCTCTATCCCCAGTGATCTGTTCCTCAATTTAAGGTACCTCCATGTCCTTGATTTGAACCGACAAGAAATTACAGAATTGCCAGAATCTGTTGGAAAATTAAAGATGCTCCGATACTTGAACCTATCAGGCACTGTTGTAAGAAAGCTGCCTTCATCAATTGGTAAGCTCTATTGCTTGCAAACACTTAAGTTACGAAACTGCTCGCATAATCTTGTAAATCTCCTATCCCTCGAAGCAAGAACTGAACTGATCACTGGCATAGCCAGAATAGGGAAATTGACTTGCCTTCAAAAGTTGGAGGAATTTGTTGTCCATAAGGACAAAGGATACAAGGTTAGTGAATTGAAGGCTATGAATAAGATCGGAGGACATATCTGCATTAAAAATCTAGAGAGCGTGTCTAGTGCGGAAGAAGCAGATGAAGCATTGCTAAGTGAGAAGGCACACATCAGCATTCTAGACCTTATATGGTCCAGTAGCAGGGATTTTACTTCAGAAGAAGCAAACCAGGACATAGAAACACTCACATCCCTCGAACCACATGATGAACTCAAGGAGCTGACAGTCAAGGCATTTGCAGGATTCGAATTTCCACATTGGATACTCTCACATTTGCAAACTATCCATCTGTCTGACTGTACAAATTGTTCAATTCTGCCAGCACTTGGACAGCTGCCTCTACTCAAGGTTATAATCATTGGGGGTTTTCCTACCATTATTAAAATTGGAGATGAGTTTTCAGGTAGTAGTGAAGTTAAGGGGTTTCCGTCACTGAAAGAACTTGTATTTGAAGACACGCCTAATCTCGAAAGGTGGACTTCCACACAAGATGGTGAGTTTCTTCCATTCCTTAGAGAACTTCAAGTGCTTGACTGTCCCAAAGTAACAGAATTGCCACTTCTCCCATCAACACTAGTGGAACTGAAAATTTCTGAGGCAGGCTTTTCTGTACTTCCTGAAGTTCATGCTCCAAGATTTCTACCATCATTGACACGCCTACAGATTCACAAATGCCCCAATCTCACATCCTTGCAGCAAGGATTGCTTAGTCAGCAATTATCAGCCCTCCAGCAACTAACCATCACTAACTGTCCAGAACTAATTCACCCCCCAACTGAAGGATTACGAACTTTAACTGCTCTTCAGAGTCTTCACATTTATGATTGTCCAAGGCTGGCAACAGCAGAACATCGTGGCTTACTACCTCGCATGATTGAAGATCTACGCATCACCTCATGCTCCAACATAATCAATCCTCTTCTTGATGAACTTAATGAGCTCTTTGCTCTCAAGAATCTTGTCATTGCGGATTGCGTTAGCCTTAATACTTTTCCAGAAAAGTTACCGGCTACCCTCAAAAAATTGGAGATCTTCAATTGCAGTAATCTGGCCTCCTTGCCTGCTTGTTTACAAGAAGCCTCTTGTCTAAAAACTATGACTATCTTAAATTGTGTTAGCATAAAATGCTTGCCAGCACATGGACTTCCACTGTCCTTAGAAGAATTATACATCAAAGAGTGCCCATTTCTGGCAGAGAGGTGTCAAGAAAACAGTGGAGAAGATTGGCCTAAAATATCTCATATAGCCATCATAGAGATTGACGATGATAGTGCCATGCCAGATAGGAGCATAAGGAGAAGATTATGCTAAAAGCTTCTTAGCAACTCAACAAAAAGGGTATGAATTAATTGCCTTCTCTAGTTTCTTTTGTCTAAATATAATAGATAAGGCTGGCTGTGAACATCATACTCAAACCTATTCTCTGCAGGTGCAATTGGTATATATTCAGTTTATTATCTCCaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Os.81769 translated coding region predicted by ESTScan from UniGene Os.81769

MPIGEAVLSAFMQALFEKAVAAASSELKFPQNIAVELQNLSSSLSTILAHVEDAEERQLKDQAARSWLSRLKDVAYEMDDLLDEHAAEVLRSKLAGPSNYHHLKVRICFCCIWLKNGLFNRDLVKQIMRIEGKIDRLIKDRHIVDPIMRFNREEIRERPKTSSLIDDSSVYGREEDKEVIVNMLLTTNNSNHVNLSILPIVGMGGVGKTTLTQLVYNDVRVKKHFQLRMWLCVSENFDEAKLTKETIESVASGLSSATTNMNLLQEDLSNKLKGKRFLLVLDDVWNEDPDRWDRYRCALVAGAKGSKIMVTTRNENVGKLVGGLTPYYLKQLSYNDCWHLFRSYAFADGDSSAHPNLEMIGKEIVHKLKGLPLAARALGSLLCAKDNEDDWKNILESEIWELPSDKNNILPALRLSYNHLPPILKRCFAFCSVFHKDYVFEKDILVQIWMAVGYIQPQGRRRMEEIGNNYFDELLSRSFFQKHKDGYVMHDAMHDLAQSVSIDECMRLDNLPNNSTTERNARHLSFSCDNKSQTTFEAFRGFNRARSLLLLNGYKSKTSSIPSDLFLNLRYLHVLDLNRQEITELPESVGKLKMLRYLNLSGTVVRKLPSSIGKLYCLQTLKLRNCSHNLVNLLSLEARTELITGIARIGKLTCLQKLEEFVVHKDKGYKVSELKAMNKIGGHICIKNLESVSSAEEADEALLSEKAHISILDLIWSSSRDFTSEEANQDIETLTSLEPHDELKELTVKAFAGFEFPHWILSHLQTIHLSDCTNCSILPALGQLPLLKVIIIGGFPTIIKIGDEFSGSSEVKGFPSLKELVFEDTPNLERWTSTQDGEFLPFLRELQVLDCPKVTELPLLPSTLVELKISEAGFSVLPEVHAPRFLPSLTRLQIHKCPNLTSLQQGLLSQQLSALQQLTITNCPELIHPPTEGLRTLTALQSLHIYDCPRLATAEHRGLLPRMIEDLRITSCSNIINPLLDELNELFALKNLVIADCVSLNTFPEKLPATLKKLEIFNCSNLASLPACLQEASCLKTMTILNCVSIKCLPAHGLPLSLEELYIKECPFLAERCQENSGEDWPKISHIAIIEIDDDSAMPDRSIRRRLC

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF147
5-1105 PTHR23155:SF147,OS05G0492600 PROTEIN

EAVLSAFMQALFEKAVAAASSELKFPQNIAVELQNLSSSLSTILAHVEDAEERQLKDQAARSWLSRLKDVAYEMDDLLDEHAAEVLRSKLAGPSNYHHLKVRICFCCIWLKNGLFNRDLVKQIMRIEGKIDRLIKDRHIVDPIMRFNREEIRERPKTSSLIDDSSVYGREEDKEVIVNMLLTTNNSNHVNLSILPIVGMGGVGKTTLTQLVYNDVRVKKHFQLRMWLCVSENFDEAKLTKETIESVASGLSSATTNMNLLQEDLSNKLKGKRFLLVLDDVWNEDPDRWDRYRCALVAGAKGSKIMVTTRNENVGKLVGGLTPYYLKQLSYNDCWHLFRSYAFADGDSSAHPNLEMIGKEIVHKLKGLPLAARALGSLLCAKDNEDDWKNILESEIWELPSDKNNILPALRLSYNHLPPILKRCFAFCSVFHKDYVFEKDILVQIWMAVGYIQPQGRRRMEEIGNNYFDELLSRSFFQKHKDGYVMHDAMHDLAQSVSIDECMRLDNLPNNSTTERNARHLSFSCDNKSQTTFEAFRGFNRARSLLLLNGYKSKTSSIPSDLFLNLRYLHVLDLNRQEITELPESVGKLKMLRYLNLSGTVVRKLPSSIGKLYCLQTLKLRNCSHNLVNLLSLEARTELITGIARIGKLTCLQKLEEFVVHKDKGYKVSELKAMNKIGGHICIKNLESVSSAEEADEALLSEKAHISILDLIWSSSRDFTSEEANQDIETLTSLEPHDELKELTVKAFAGFEFPHWILSHLQTIHLSDCTNCSILPALGQLPLLKVIIIGGFPTIIKIGDEFSGSSEVKGFPSLKELVFEDTPNLERWTSTQDGEFLPFLRELQVLDCPKVTELPLLPSTLVELKISEAGFSVLPEVHAPRFLPSLTRLQIHKCPNLTSLQQGLLSQQLSALQQLTITNCPELIHPPTEGLRTLTALQSLHIYDCPRLATAEHRGLLPRMIEDLRITSCSNIINPLLDELNELFALKNLVIADCVSLNTFPEKLPATLKKLEIFNCSNLASLPACLQEASCLKTMTILNCVSIKCLPAHGLPLSLEELYIKECPFLAERCQENSGEDWPKISHIAIIEIDDDSAMPDRSIRR

HMMPanther: PTHR23155
5-1105 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EAVLSAFMQALFEKAVAAASSELKFPQNIAVELQNLSSSLSTILAHVEDAEERQLKDQAARSWLSRLKDVAYEMDDLLDEHAAEVLRSKLAGPSNYHHLKVRICFCCIWLKNGLFNRDLVKQIMRIEGKIDRLIKDRHIVDPIMRFNREEIRERPKTSSLIDDSSVYGREEDKEVIVNMLLTTNNSNHVNLSILPIVGMGGVGKTTLTQLVYNDVRVKKHFQLRMWLCVSENFDEAKLTKETIESVASGLSSATTNMNLLQEDLSNKLKGKRFLLVLDDVWNEDPDRWDRYRCALVAGAKGSKIMVTTRNENVGKLVGGLTPYYLKQLSYNDCWHLFRSYAFADGDSSAHPNLEMIGKEIVHKLKGLPLAARALGSLLCAKDNEDDWKNILESEIWELPSDKNNILPALRLSYNHLPPILKRCFAFCSVFHKDYVFEKDILVQIWMAVGYIQPQGRRRMEEIGNNYFDELLSRSFFQKHKDGYVMHDAMHDLAQSVSIDECMRLDNLPNNSTTERNARHLSFSCDNKSQTTFEAFRGFNRARSLLLLNGYKSKTSSIPSDLFLNLRYLHVLDLNRQEITELPESVGKLKMLRYLNLSGTVVRKLPSSIGKLYCLQTLKLRNCSHNLVNLLSLEARTELITGIARIGKLTCLQKLEEFVVHKDKGYKVSELKAMNKIGGHICIKNLESVSSAEEADEALLSEKAHISILDLIWSSSRDFTSEEANQDIETLTSLEPHDELKELTVKAFAGFEFPHWILSHLQTIHLSDCTNCSILPALGQLPLLKVIIIGGFPTIIKIGDEFSGSSEVKGFPSLKELVFEDTPNLERWTSTQDGEFLPFLRELQVLDCPKVTELPLLPSTLVELKISEAGFSVLPEVHAPRFLPSLTRLQIHKCPNLTSLQQGLLSQQLSALQQLTITNCPELIHPPTEGLRTLTALQSLHIYDCPRLATAEHRGLLPRMIEDLRITSCSNIINPLLDELNELFALKNLVIADCVSLNTFPEKLPATLKKLEIFNCSNLASLPACLQEASCLKTMTILNCVSIKCLPAHGLPLSLEELYIKECPFLAERCQENSGEDWPKISHIAIIEIDDDSAMPDRSIRR

superfamily: SSF52540
153-405 SSF52540

EEIRERPKTSSLIDDSSVYGREEDKEVIVNMLLTTNNSNHVNLSILPIVGMGGVGKTTLTQLVYNDVRVKKHFQLRMWLCVSENFDEAKLTKETIESVASGLSSATTNMNLLQEDLSNKLKGKRFLLVLDDVWNEDPDRWDRYRCALVAGAKGSKIMVTTRNENVGKLVGGLTPYYLKQLSYNDCWHLFRSYAFADGDSSAHPNLEMIGKEIVHKLKGLPLAARALGSLLCAKDNEDDWKNILESEIWELPSD

Gene3D: G3DSA:3.40.50.300
172-316 G3DSA:3.40.50.300

GREEDKEVIVNMLLTTNNSNHVNLSILPIVGMGGVGKTTLTQLVYNDVRVKKHFQLRMWLCVSENFDEAKLTKETIESVASGLSSATTNMNLLQEDLSNKLKGKRFLLVLDDVWNEDPDRWDRYRCALVAGAKGSKIMVTTRNEN

HMMPfam: PF00931
IPR002182
174-457 NB-ARC,NBS
NB-ARC

EEDKEVIVNMLLTTNNSNHVNLSILPIVGMGGVGKTTLTQLVYNDVRVKKHFQLRMWLCVSENFDEAKLTKETIESVASGLSSATTNMNLLQEDLSNKLKGKRFLLVLDDVWNEDPDRWDRYRCALVAGAKGSKIMVTTRNENVGKLVGGLTPYYLKQLSYNDCWHLFRSYAFADGDSSAHPNLEMIGKEIVHKLKGLPLAARALGSLLCAKDNEDDWKNILESEIWELPSDKNNILPALRLSYNHLPPILKRCFAFCSVFHKDYVFEKDILVQIWMAVGYIQP

FPrintScan: PR00364
IPR000767
197-212 DISEASERSIST
Disease resistance protein

ILPIVGMGGVGKTTLT

FPrintScan: PR00364
IPR000767
271-285 DISEASERSIST
Disease resistance protein

KLKGKRFLLVLDDVW

FPrintScan: PR00364
IPR000767
368-382 DISEASERSIST
Disease resistance protein

LKGLPLAARALGSLL

superfamily: SSF52058
488-963 SSF52058,LRR

VMHDAMHDLAQSVSIDECMRLDNLPNNSTTERNARHLSFSCDNKSQTTFEAFRGFNRARSLLLLNGYKSKTSSIPSDLFLNLRYLHVLDLNRQEITELPESVGKLKMLRYLNLSGTVVRKLPSSIGKLYCLQTLKLRNCSHNLVNLLSLEARTELITGIARIGKLTCLQKLEEFVVHKDKGYKVSELKAMNKIGGHICIKNLESVSSAEEADEALLSEKAHISILDLIWSSSRDFTSEEANQDIETLTSLEPHDELKELTVKAFAGFEFPHWILSHLQTIHLSDCTNCSILPALGQLPLLKVIIIGGFPTIIKIGDEFSGSSEVKGFPSLKELVFEDTPNLERWTSTQDGEFLPFLRELQVLDCPKVTELPLLPSTLVELKISEAGFSVLPEVHAPRFLPSLTRLQIHKCPNLTSLQQGLLSQQLSALQQLTITNCPELIHPPTEGLRTLTALQSLHIYDCPRLATAEHRGLLPRM

Gene3D: G3DSA:3.80.10.10
538-665 G3DSA:3.80.10.10

AFRGFNRARSLLLLNGYKSKTSSIPSDLFLNLRYLHVLDLNRQEITELPESVGKLKMLRYLNLSGTVVRKLPSSIGKLYCLQTLKLRNCSHNLVNLLSLEARTELITGIARIGKLTCLQKLEEFVVHK

Gene3D: G3DSA:3.80.10.10
762-950 G3DSA:3.80.10.10

SHLQTIHLSDCTNCSILPALGQLPLLKVIIIGGFPTIIKIGDEFSGSSEVKGFPSLKELVFEDTPNLERWTSTQDGEFLPFLRELQVLDCPKVTELPLLPSTLVELKISEAGFSVLPEVHAPRFLPSLTRLQIHKCPNLTSLQQGLLSQQLSALQQLTITNCPELIHPPTEGLRTLTALQSLHIYDCPR

FPrintScan: PR00364
IPR000767
910-926 DISEASERSIST
Disease resistance protein

QQLSALQQLTITNCPEL

Gene3D: G3DSA:3.80.10.10
964-1089 G3DSA:3.80.10.10

IEDLRITSCSNIINPLLDELNELFALKNLVIADCVSLNTFPEKLPATLKKLEIFNCSNLASLPACLQEASCLKTMTILNCVSIKCLPAHGLPLSLEELYIKECPFLAERCQENSGEDWPKISHIAI

superfamily: SSF52058
977-1086 SSF52058,LRR

NPLLDELNELFALKNLVIADCVSLNTFPEKLPATLKKLEIFNCSNLASLPACLQEASCLKTMTILNCVSIKCLPAHGLPLSLEELYIKECPFLAERCQENSGEDWPKISH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox