PRGDB00073159 (Os.82652)

From PRG Wiki
Jump to: navigation, search
Os.82652
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 40491806 (BX901701)
Gene Class Unknown
Domain Type LRR
Gene Species Oryza sativa Japonica Group

Comment?

BX901701 Oryza sativa library (Han B) Oryza sativa cDNA clone p740b07p3, mRNA sequence

DNA Sequence

GnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnttttttttttGGAAAAATGAAAGTTTGTTTCAAACGCAAAAGGTCTAAAACGCTTTCTTCCTTTCACACATATTTCCACCAAAAAATAAACAACTTTTTGACCATTCAACACAATGCACATGTCAATTGCACATCCCACACGGCCACACTTCCAATAAAACCACCAATAGAACCAGCACACTGCTCATGCGTAATTGTGTATCCTCATCATCAACCTTCATTCCTTCACTACCATGGCTCTTCTCTGCATCAGCATGGTGCTCCTCATCCTATTGGCACCATGCGCCACTTCACTCACCCCTCCATCCAACAACACAGACCTCGCTGCACTGCTCGACTTCAAGGAGCAAGTCAAGGACCCTAATGGCATCCTTGCCAGCAATTGGACTGCCAGTGCACCCTTCTGCTCGTGGATTGGGGTCTCATGCGACAGCAGCGGGAAGTGGGTCACTGGGCTTGAGTTTGAAGACATGGCACTTGAAGGAACCATCAGCCCnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnTGGTGGCCGTCACATCGCACAGACATCCATAAAGAACCCATATACACAAAACCAGAAATCA


Protein sequences

Name Description Sequence
Os.82652 translated coding region predicted by ESTScan from UniGene Os.82652

MALLCISMVLLILLAPCATSLTPPSNNTDLAALLDFKEQVKDPNGILASNWTASAPFCSWIGVSCDSSGKWVTGLEFEDMALEGTISPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVAVTSHRHP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF474
1-88 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MALLCISMVLLILLAPCATSLTPPSNNTDLAALLDFKEQVKDPNGILASNWTASAPFCSWIGVSCDSSGKWVTGLEFEDMALEGTISP

HMMPanther: PTHR24420
1-88 FAMILY NOT NAMED,FAMILY NOT NAMED

MALLCISMVLLILLAPCATSLTPPSNNTDLAALLDFKEQVKDPNGILASNWTASAPFCSWIGVSCDSSGKWVTGLEFEDMALEGTISP

Seg: seg
3-14 seg

LLCISMVLLILL

superfamily: SSF52058
23-88 L domain-like,LRR

PPSNNTDLAALLDFKEQVKDPNGILASNWTASAPFCSWIGVSCDSSGKWVTGLEFEDMALEGTISP

Gene3D: G3DSA:3.80.10.10
26-88 no description

NNTDLAALLDFKEQVKDPNGILASNWTASAPFCSWIGVSCDSSGKWVTGLEFEDMALEGTISP

HMMPfam: PF08263
IPR013210
26-66 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NNTDLAALLDFKEQVKDPNGILASNWTASAPFCSWIGVSCD

Seg: seg
88-107 seg

PXXXXXXXXXXXXXXXXXXX

Seg: seg
108-127 seg

XXXXXXXXXXXXXXXXXXXV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox