PRGDB00073187 (Os.85116)

From PRG Wiki
Jump to: navigation, search
Os.85116
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 116010662 (AK241297)
Gene Class N
Domain Type NBS
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group cDNA, clone: J065139H12, full insert sequence

DNA Sequence

GATCCATCTCTACACATCAGCAATATTTAGCTACACAGAGCTATCTAGGATTAGCTGATCAGCAATGGCAGGTGCTCCTCGAGGACTAGTTCTCCTCGGCGTTTGTGCCGTCTTGATGGCGGTCGCCGTCGGCGGAGAGGCGGCGTCGGTGGTCGTCGGCACGGCCAAGTGCGCCGACTGCACCCGGAAGAACATGAAAGCTGAGGATGCTTTCAAGAACCTCCAGGTGGCGATTAAGTGCAAGAACGGCAACGGCGAGTACGAGAGCAAGGCCACTGGAAAGCTCGACGGCACCGGTGCCTTCAGCGTCCCCCTTGACGCCGACCTCCACAGCTCCGACTGCATCGCTCAGCTCCACAGCGCCACCAACGAGCCATGCCCCGGCCAGGAGCCATCCAAGATCGTGCCAATGTCGGAGGGCACCTTTGCTGCCGTCGCCGGCAAGACCCACTACCGATCGGCGTTGTGCGCGTCCGTGACCATCTGCGGCCCAATCAAGAAGAAGATCATAGACCACTTCCACAAGAAGCCGGTGCCACCCAAGCCGGAGCCAAAGCCGGAGCCACCCAAGCCCAAGCCTGAGCCGGAGCACCCATTCCTCGACCACATCCACAAGAAGGAGAAGCACTTCTTCGACCACTTCCACAAGAAGCCCGTGCCACCCAAGCCTGAGCCTAAGCCCGAGCCCAAGCCGCAGCCTGCGCCAGAGTACCACAACCCTAGCCCTCCGGCGAATTAAGCAATGGAAGTTTGCATGCATGCATGGTTCGTTTGGTTAGTACGTTTGGTGTTGTTGCATATGATTTCCTGTCATGTCAGTTTGTCTGCAGAATAATGGTTTTCTTTGATGCATTAGCTTTTACTCACAAGTTTAATTtgtgtgtgtgtgtCTATTTGTTTGGTATCAGCAAGTAATTAATATAATCAGGGATGTGCATAATATATGTGCAACTTGTTTGATCTCaaaaaaaaaaaaaaaagagcctttggatccaacaccttttttttttttttttttGAGAAAAAAGATGACAGATCTATGATCCGGGCAAAGATGGAATAATACAATGAATCAATGATGATGATGACAGCAACATAAAATAAATTAAAAGTAGATGATCTCAGTGGTACAGTACAAGGGCGGGCAGGCAGCAGCTAGCAGAGTCATATCGTGGGCGTAGCagagagaagaagaagaagaagaaagaaacaaaagaaTCCGAGGCATGGCGATCGCTCAATCATCAAATGTGGTTGGGAGAGTGGTAAAGCCAAAGCCAAAGCTAAGGtccctcctcctcctccctcccGTCCCGTAAAAGAATCGACGAGCAAAATACAGCGCAAAATGTGGTGGGGCGCACCGGCCGCTGCCATCTGCGTCGTCGTCGTTGCTCACGTCGTTGCACGACGCCGTTTTGCTTAGGCGAGGAGGGCGACGAGGCCGAGCGCCACGGCGCACGCCGACGCGATCGCCTGCACGCTGGTCCTCCCTGCGGCTCCCGTGGAGTCGGCGGCGACACCGTCGCcggcggggccgggggcgtcggccgtggacgaggcggcgggggccttagccttcttggagtgcttgggggactcggcgacggcgacgggggccggggcgggggccttggagctcttcttcttcttcttggatggcggggagggcttcttcttcttggccggcgccggcgcgggtgcgtcgggcttggtggggatggtggcgggcgcctcggcggcgggggAAGGAGGCGACGCGACGGGAGCCTCGACCGGGGGAGACGAGGCCGGCGGCGGGGTGGCCTTGGCCGCCTTGGGCGCCGGAGCGGGTGCCTTGGTGGACTTGgtgggtggcgctttggtcggagccggggtggtgggcgcctcggcgggggccggggtggcgggggtggtcggcgccgcggcgggcggggtggaggcggcgggcggggtggtggtggtgggcgccgcggcgggcgcgggcgTCTTCTTGGAGGAGGCCGGTGGCGTGGTGGCCGGCGCCGCGGCGGGGGTGGGGGTCGCCTTCTGCGCGGACGCGGACGCCGCGACGAGGCAGAGCAGCGCGAGGCAGAGTGCGGCTGCGCGCGCCattgcggcggtggtggtttgctcggctcggtgcggcgacggtggtggtggtggtggtggtggGGAGCTGGTTCTATAGTGTCACCTAAATAGAGCTCGAGCTCTATTTAGGTGACACTATAGAACCAGGCCTTGGATCATCCTTACTAATGCTTACAAAGCATACCTTTGAGACAAGGAACATGAAGGTTCTTGAGGACCTCATTGCCCCGGCATTCTTCGCGGATCTTGTGAGCCGGCTCATCGCCTTCCTGATCAGCCGATACAGCAACCGAGCATGCTTCGAGGAGACAGCCATCAAGCTCGAGCTGCTCGTGCTCAAGATCCATGCTGTCATCCAAGAGGCTGAGCATCGTCATATCGCAGGTAACCAGAGTCTTCTCCTGTGGCTCAAGAAGCTCATTAAAGGGATGTACCAAGCATATTATGTGCTTGATAATGCAAGGCACCCCCAAGATGATCAGTACATAAATTCAGTTGTGACCAGTGGCCGGTCAGTTTCCTTGTCTCGTTTCTGCTGCCCTGCCAAGCGACCCCGTACGGTCGCGATGGATTTCCAAGTCAACAACAATGGTAGCATCCATCAGCTAAGTTCCACCCTGGCGTTCTTAGAAGATTATTCTGCAAACTTGAGGGATCTCATTCTGCTTCTGGCATGCTGCCCTCCATTACCAATTAGGCAGCCTGTCAGTGACTTTCTGTCTGATGAGAGAAACATGTTTGGCAGGCTAGTAGAGAGGGAGCAGATCATCAGCTTCCTGATGCAGCCTGGGAACCATCTTGGTGTACTCCCTATAGTTGGTGGTCCAGAGGTTGGAAAGGGCACCATCATCAAGCATGTTTGCAACGATGACAGAGTGCGCAATCGCTTCGACATGATCCTGTACTCCTATGGATCAATTCTTCAGATAAATCCTGCTGATGATGTGTTGGAAACACTAACAAGTCATGGCCACATTCTTCACCAGGCCGATGTTTCAACCTCTTCACTGCACAGGAAGCATCTCATTGTGATAAAAAACACATATGAAGTAGTGATTGACAAGGTAGCATGGGCTACACTCTGTGCTTCTCTAAGATCAATTGGAAATGGAAGCAAGATCATAATAGTCAGCGAGAATGACAACATCAAAGATCTTGGTACGACGGGAGCGATGCGGATCGATCCATTACTCCAAGAGGAATACTGGTACTTCTTCAGGTCACTTGCCTTTGGTTCAGGTTCTAGCATTCTAGAGGAGCATGCAGGGCTCGCTGTGGTTGGCAGACAAATTGCAGCAGAACTTCATGGCTCATTGTTTGGAGCCAAGGTACTCGGTAGGTTTCTAAGGGCAAACCTTGATGAACAGTTTTCGCACACTATGCTTAACACCGTGTACAGATTCCATGAAGTGATGCAACGTGACAAGTATTTCACCAAGCTCAGCATCGCTCGTGTGGCTCTGAAGGTGCTTCCAATGCCTCTTAGGCTAAAGAGTGCTTCTCAGACCGGCGAGGCTTCAGAGATGCCTGGCACTATGGTTCAAGAACTAGTTGCCGGCAGCGTTCTTCCTGTAGAGAAAGAGATGGAGGTTGTGCTGTGGGAGTCTGCCTACCAGCCGAGTTACCGCTACACCGTTGTTTGTGAGAGAGTTGAGAAGCCTCGTTGCAGTGCAACCAAACGAATGAAGCAGAAGTAAATGATCAATAGTGATTCCCTTTGGTCATGAAAACAAGTTATTTTCAACATTTCTCCGGTCAAACTTTCAAGTTTGAATATCATACTTGTTAAATTTATAGACTTGATGTATGAATGAAAATTATTGTTGGTATTTATTACGGTCATAGATAAATCAGCAAGCACAC


Protein sequences

Name Description Sequence
Os.85116 translated coding region predicted by ESTScan from UniGene Os.85116

MAIAQSSNVVGRXGKAKAKAKVPPPPPSRPVKESTSKIQRKMWWGAPAAAICVVVVAHVVARRRFAXARRATRPSATAHADAIACTLVLPAAPVESAATPSPAGPGASAVDEAAGALAFLECLGDSATATGAGAGALELFFFFLDGGEGFFFLAGAGAGASGLVGMVAGASAAGEGGDATGASTGGDEAGGGVALAALGAGAGALVDLVGGALVGAGVVGASAGAGVAGVVGAAAGGVEAAGGVVVVGAAAGAGVFLEEAGGVVAGAAAGVGVAFCADADAATRQSSARQSAAARAIAAVVVCSARCGDGGGGGGGGELVLSVTXIELELYLGDTIEPGLGSSLLMLTKHTFETRNMKVLEDLIAPAFFADLVSRLIAFLISRYSNRACFEETAIKLELLVLKIHAVIQEAEHRHIAGNQSLLLWLKKLIKGMYQAYYVLDNARHPQDDQYINSVVTSGRSVSLSRFCCPAKRPRTVAMDFQVNNNGSIHQLSSTLAFLEDYSANLRDLILLLACCPPLPIRQPVSDFLSDERNMFGRLVEREQIISFLMQPGNHLGVLPIVGGPEVGKGTIIKHVCNDDRVRNRFDMILYSYGSILQINPADDVLETLTSHGHILHQADVSTSSLHRKHLIVIKNTYEVVIDKVAWATLCASLRSIGNGSKIIIVSENDNIKDLGTTGAMRIDPLLQEEYWYFFRSLAFGSGSSILEEHAGLAVVGRQIAAELHGSLFGAKVLGRFLRANLDEQFSHTMLNTVYRFHEVMQRDKYFTKLSIARVALKVLPMPLRLKSASQTGEASEMPGTMVQELVAGSVLPVEKEMEVVLWESAYQPSYRYTVVCERVEKPRCSATKRMKQK

Domains

Domain Start-End Description Sequence

Seg: seg
9-32 seg

VVGRXGKAKAKAKVPPPPPSRPVK

Seg: seg
46-80 seg

APAAAICVVVVAHVVARRRFAXARRATRPSATAHA

Seg: seg
96-109 seg

SAATPSPAGPGASA

Seg: seg
123-307 seg

LGDSATATGAGAGALELFFFFLDGGEGFFFLAGAGAGASGLVGMVAGASAAGEGGDATGASTGGDEAGGGVALAALGAGAGALVDLVGGALVGAGVVGASAGAGVAGVVGAAAGGVEAAGGVVVVGAAAGAGVFLEEAGGVVAGAAAGVGVAFCADADAATRQSSARQSAAARAIAAVVVCSARC

Seg: seg
308-317 seg

GDGGGGGGGG

Seg: seg
509-521 seg

LILLLACCPPLPI

HMMPfam: PF00931
IPR002182
543-750 NB-ARC,NBS
NB-ARC

EQIISFLMQPGNHLGVLPIVGGPEVGKGTIIKHVCNDDRVRNRFDMILYSYGSILQINPADDVLETLTSHGHILHQADVSTSSLHRKHLIVIKNTYEVVIDKVAWATLCASLRSIGNGSKIIIVSENDNIKDLGTTGAMRIDPLLQEEYWYFFRSLAFGSGSSILEEHAGLAVVGRQIAAELHGSLFGAKVLGRFLRANLDEQFSHTM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox