PRGDB00073188 (Os.85168)

From PRG Wiki
Jump to: navigation, search
Os.85168
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 116011989 (AK242624)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group cDNA, clone: J090020C13, full insert sequence

DNA Sequence

GACAAAAATAATACTCTTTGCTTCGATATTTTATATTTGTGCTGCATGGGAAAAATTGCCATAATTCAATTTCCTTGCAGGATTTTCTTGCAAGCCACTAGATATGGACCCATGAAACGGACGAGGACGGCATCTTACTGAAATAGTACAGCGAGGAGTACTCTGCACACCGTGGTTGGATGGAGATATACATCGCAACAACTGAACAAGGTAATCACATCAACTGATGTGTTTCTTATTACTTTTAATACATGGTAATAAAGAGCGACGATTCATACTTCATACAGTTAATCAGCATTACTATGCAGCACGTCAACTAAGTATAACTCCCATAACATTACTATGATTTATGGCACAACATGGCTTTCATATGAAACAAATGGCTTAGGGGGCACCTCTATATTCTGCAACCTTCCAGTTAGCATGTTTACAACCTTCGTCATTGTGGGACGGTTTCTTGGGTTCCACTGAATGCACCACAGTGCCACGAGGGCCATCTGTCTAACCTTCAGTCTACTTCTTCTGTCATTTCCCTACTAAGTACAAAGTCCTGCTCAGTAATTACTTTCTCATAGATCCACTCTGGAAAGTAGACCTCATTTTGGTTCTCAATACTCGGGTCTGAGTTTCTCCTTCCACTCACCATTTCTAACACAAGCATGCCAAAACTATATACATCTGACTTGTAAGATATCTCCCCAAAGTTCCTAGAATATAGCTCTGGTGCAATGTAGCCCATCGTGCCTCTTGCTTTGGTCAAGGTAACAATGCTTTGGTCCCTTGCACACAGCTTTGCAAGACCAAAGTCTGAAATCTTCGGATTGAAGTTATAGTCAAGCAATATATTATTAGGCTTGATATCAAAATGGAGGATGCGTTGGTTGCATCCTTGATGAAGATACTCCATTCCTCGGGCAATGCCTAAGGCAACATCTAACATCTTTTTTGGTGCTAGGAGTTCTTGAGAAGTATTAGGGTCATGCAAGAATATGCATTTCTCCAATGATTCATTAGGCATGAATTCATAGATAAGAATGTGCCGTGTTCCTTCAGAGCAGAATCCCAGAAGGCGGGCAATGTTTATATGATGAATTTGTCCAATTGTTGCTACTTCATTGATGAACTCTTCTCCATTTCCTGTAGAGTGTTCTATCATTTTAACTGCCACAGGCACTCCGTTTGGTAGTCGTCCTTTGTATACACTTCCAAATCCACCCTGACCTAATTGTTCCTTGAAGCGTCTCGTTATCTTCTTAACATCAGAGAAACTGTACCTTGTGGGCTTCGATGTGCCATATGTCCTGAGGAACATTTCAACCTTCAAATGTACCTCTTCATCATACCTTGACTTCAGTGAAAGATAGAGTGCTGTGGCCATGATGAACGAAAAAACAACAAATGCGGCTACCGATGATGTAGCTGAATTAACAGAGAAGGGGAAATTAGCACATTGCATTAGGATCGAAAGTTGTGGCTAGTAATCAACTGATTGTGATTGCCTGATGGGTACTGTAAGAGCAGGTGGTGTCTTTTTTAGCAGAAGAATGCTGAGTCAGAAGACTCAGAACTGCTAGCAATAAGAATTTATATGTACTGATAACATTGTTTCTTTTCTCTTTTTAATAGAAAGGTAGGTTTGAGTACTGCAGTACCTGAAATGACTTTCACACGCTAACCTGCAAGTATGAACGAAGATAATAAGTTCTGGTTGGTGGTTTTAACAGATAATGGATAATTACATCTTGAAAATAAAAACAGAGCAATCCAACAAAATGTATCAGCGAACATGGCCCTGGTGGGGTAGGATAGAGTTTTGGCTCTAAATTTTTATGCACCATGATCATATGAATATATTTGCAATAGTGAAATTTTCCTTACATCTTATTTTGCAGTATCATCATAAGACAGTTCTGTGTGCTAACTCTCGTATTTTTGTCATGCCAGATAAGGATGATTAGGATGAGTTGAGGTGGGTTATGGGCTAAATTATAAAGGCTTCCACATATCACCTCCCATGTCTACTAATCTATTATCAAAGCAACCAAAGATCTAACTGCAGCTCCTGTTATATCAGGTAACAAACCAAAACTTAGATTATATCGTGTATACCTCTGTAATTATTCCTTTATCTTAATGAATTTTGGTCGGCTTCCTTTCGCCGACCTGGC


Protein sequences

Name Description Sequence
Os.85168 translated coding region predicted by ESTScan from UniGene Os.85168

MATALYLSLKSRYDEEVHLKVEMFLRTYGTSKPTRYSFSDVKKITRRFKEQLGQGGFGSVYKGRLPNGVPVAVKMIEHSTGNGEEFINEVATIGQIHHINIARLLGFCSEGTRHILIYEFMPNESLEKCIFLHDPNTSQELLAPKKMLDVALGIARGMEYLHQGCNQRILHFDIKPNNILLDYNFNPKISDFGLAKLCARDQSIVTLTKARGTMGYIAPELYSRNFGEISYKSDVYSFGMLVLEMVSGRRNSDPSIENQNEVYFPEWIYEKVITEQDFVLSREMTEEVXLKVRQMALVALWCIQWNPRNRPTMTKVVNMLTGRLQNIEVPPKPFVSYESHVVP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF441
1-340 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MATALYLSLKSRYDEEVHLKVEMFLRTYGTSKPTRYSFSDVKKITRRFKEQLGQGGFGSVYKGRLPNGVPVAVKMIEHSTGNGEEFINEVATIGQIHHINIARLLGFCSEGTRHILIYEFMPNESLEKCIFLHDPNTSQELLAPKKMLDVALGIARGMEYLHQGCNQRILHFDIKPNNILLDYNFNPKISDFGLAKLCARDQSIVTLTKARGTMGYIAPELYSRNFGEISYKSDVYSFGMLVLEMVSGRRNSDPSIENQNEVYFPEWIYEKVITEQDFVLSREMTEEVXLKVRQMALVALWCIQWNPRNRPTMTKVVNMLTGRLQNIEVPPKPFVSYESH

HMMPanther: PTHR24420
1-340 FAMILY NOT NAMED,FAMILY NOT NAMED

MATALYLSLKSRYDEEVHLKVEMFLRTYGTSKPTRYSFSDVKKITRRFKEQLGQGGFGSVYKGRLPNGVPVAVKMIEHSTGNGEEFINEVATIGQIHHINIARLLGFCSEGTRHILIYEFMPNESLEKCIFLHDPNTSQELLAPKKMLDVALGIARGMEYLHQGCNQRILHFDIKPNNILLDYNFNPKISDFGLAKLCARDQSIVTLTKARGTMGYIAPELYSRNFGEISYKSDVYSFGMLVLEMVSGRRNSDPSIENQNEVYFPEWIYEKVITEQDFVLSREMTEEVXLKVRQMALVALWCIQWNPRNRPTMTKVVNMLTGRLQNIEVPPKPFVSYESH

superfamily: SSF56112
IPR011009
20-343 Protein kinase-like (PK-like)
Protein kinase-like domain

KVEMFLRTYGTSKPTRYSFSDVKKITRRFKEQLGQGGFGSVYKGRLPNGVPVAVKMIEHSTGNGEEFINEVATIGQIHHINIARLLGFCSEGTRHILIYEFMPNESLEKCIFLHDPNTSQELLAPKKMLDVALGIARGMEYLHQGCNQRILHFDIKPNNILLDYNFNPKISDFGLAKLCARDQSIVTLTKARGTMGYIAPELYSRNFGEISYKSDVYSFGMLVLEMVSGRRNSDPSIENQNEVYFPEWIYEKVITEQDFVLSREMTEEVXLKVRQMALVALWCIQWNPRNRPTMTKVVNMLTGRLQNIEVPPKPFVSYESHVVP

Gene3D: G3DSA:3.30.200.20
31-121 no description

SKPTRYSFSDVKKITRRFKEQLGQGGFGSVYKGRLPNGVPVAVKMIEHSTGNGEEFINEVATIGQIHHINIARLLGFCSEGTRHILIYEFM

ProfileScan: PS50011
IPR000719
46-335 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

RRFKEQLGQGGFGSVYKGRLPNGVPVAVKMIEHSTGNGEEFINEVATIGQIHHINIARLLGFCSEGTRHILIYEFMPNESLEKCIFLHDPNTSQELLAPKKMLDVALGIARGMEYLHQGCNQRILHFDIKPNNILLDYNFNPKISDFGLAKLCARDQSIVTLTKARGTMGYIAPELYSRNFGEISYKSDVYSFGMLVLEMVSGRRNSDPSIENQNEVYFPEWIYEKVITEQDFVLSREMTEEVXLKVRQMALVALWCIQWNPRNRPTMTKVVNMLTGRLQNIEVPPKPFV

HMMSmart: SM00220
IPR002290
46-320 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

RRFKEQLGQGGFGSVYKGRLPNGVPVAVKMIEHSTGNGEEFINEVATIGQIHHINIARLLGFCSEGTRHILIYEFMPNESLEKCIFLHDPNTSQELLAPKKMLDVALGIARGMEYLHQGCNQRILHFDIKPNNILLDYNFNPKISDFGLAKLCARDQSIVTLTKARGTMGYIAPELYSRNFGEISYKSDVYSFGMLVLEMVSGRRNSDPSIENQNEVYFPEWIYEKVITEQDFVLSREMTEEVXLKVRQMALVALWCIQWNPRNRPTMTKVVNML

HMMSmart: SM00219
IPR020635
46-320 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

RRFKEQLGQGGFGSVYKGRLPNGVPVAVKMIEHSTGNGEEFINEVATIGQIHHINIARLLGFCSEGTRHILIYEFMPNESLEKCIFLHDPNTSQELLAPKKMLDVALGIARGMEYLHQGCNQRILHFDIKPNNILLDYNFNPKISDFGLAKLCARDQSIVTLTKARGTMGYIAPELYSRNFGEISYKSDVYSFGMLVLEMVSGRRNSDPSIENQNEVYFPEWIYEKVITEQDFVLSREMTEEVXLKVRQMALVALWCIQWNPRNRPTMTKVVNML

HMMPfam: PF07714
IPR001245
48-320 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

FKEQLGQGGFGSVYKGRLPNGVPVAVKMIEHSTGNGEEFINEVATIGQIHHINIARLLGFCSEGTRHILIYEFMPNESLEKCIFLHDPNTSQELLAPKKMLDVALGIARGMEYLHQGCNQRILHFDIKPNNILLDYNFNPKISDFGLAKLCARDQSIVTLTKARGTMGYIAPELYSRNFGEISYKSDVYSFGMLVLEMVSGRRNSDPSIENQNEVYFPEWIYEKVITEQDFVLSREMTEEVXLKVRQMALVALWCIQWNPRNRPTMTKVVNML

PatternScan: PS00107
IPR017441
52-74 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGGFGSVYKGRLPNGVPVAVK

Gene3D: G3DSA:1.10.510.10
139-326 no description

QELLAPKKMLDVALGIARGMEYLHQGCNQRILHFDIKPNNILLDYNFNPKISDFGLAKLCARDQSIVTLTKARGTMGYIAPELYSRNFGEISYKSDVYSFGMLVLEMVSGRRNSDPSIENQNEVYFPEWIYEKVITEQDFVLSREMTEEVXLKVRQMALVALWCIQWNPRNRPTMTKVVNMLTGRLQN

PatternScan: PS00108
IPR008271
169-181 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

ILHFDIKPNNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox