PRGDB00073189 (Os.85201)

From PRG Wiki
Jump to: navigation, search
Os.85201
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 297728504 (NM_001189687)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group Os11g0572301 (Os11g0572301) mRNA, complete cds

DNA Sequence

GAGAGCTGGCGGTTCCGTGGTTTGACTTTGGAGAAACCACGAAGGAGGCCTCTCCATGGCGACTCCATCTGACGCCGCGACGATCATATGGAGCACGGAGCTCGAGCTAGCTCCACTGATAGCAATGGTGAGGAACCGGGATTATTTCGCCGGCGCTCGATTCCACGTCCTCCGTGGCGCGTGCGAGCACCTGGCGCACGTCAGGGACTGCGTGCGCACGAGGGCCCGCGTGGCGGCGCGGCGGGGCAGGAGGCTGGCGACGGCGGCAGCCTGGACAGAGGAGGCGGAGATCTACCTCCTCCGGTTCGGCGAGCTGCGGAGCGCGCACGGCCGGATCCCCAGGCTCATCTTCTGGGATCTGCTCGGCTGCTACCGCGTCAGCAAGGTCGCGTCGCTGATGATGCCGCAGGTGAAGAGGCTGTGCGAAGAAGGGGGAAGGATCGTGCGCAGGAGCAAGCTGCCCCAACCGATGGAGATCTCCACGGGGTTCGCGAGCAGGGATCGTACCCTCCGGGCCGCGATCGAGAGGGTGAGGACGATCCAACCCAACGGCATCGTCGCGATCTGGGGCCGCGCCGGCTTGGGGAAGACTTACCTACTCAAGCTCGTTGAGGAGTACTTCTCCCGAGATGACACCTTCGATCTCGTGCTGCGAATCGCCTCTCCGAGAGATTCCTCCGTAGCCAAGGTACTATCTATACATGCATACTGATTTATTGCGAGTAGTATAACACTAGGATATTCAGTTTTTTTTTTGAGAGGTAGGATATTCAGTTGAGGTATTTACAAAATGAAGAGAAATAGCACATCTACAAATATATAATTTTTTTTAGCAAATGTATGATACTTTGCACTGGATATGTTGTTGACAACCATTGCATGGACAGATATAAACAATTTGGCCCTTTCATTCCATATCCATCATAAGATGCATTTCTAGCATGTAACTCTTGGCCACTTTCAGGTTCAAAGTGAAATTGCCAAGAAACTCATGTTGGCTAACTGTGACGGCATGCAACATAGAGCAAGAATTTTCGACTTCTTGAAGGAGAGAAATTTCCTTTTATTGCTTGACTGTGTATGGCAGAGACTGGATCTAGAAGAAGTTGGGATTCCATCACTTGACTTGGTTGGAAGCTGCTACAACCGAAGAGTGGTTTTCACGGCATGCTCTAGCCATGTCTGTGATCAAATGAATGTGGAAGTGGAGAACAGAATTGAGGTTCACTGTCTTGATCATACAGAATCATGGGAAATTTTCAAGCAGAATGCTGATCTTGATTACTTGGGCCATAAGCATGTGTACCTGCCAAGAAATATTTCCGCGGAATTGCTTGGTTCACCTTTGGAGCTGGTAACAATTGGAAAGGCCATGCACAATAAGAAGGATGCAATATATTGGCAAAATGCCCTTCATTATCTGACTGAATCATGCCTTCGTGACACTCAATGGTCAGGTAGTGAAGAGGCAACATTTTTCAGATTAAAACTTGCGTATGACAGCTTGACAGGAATTCTGAAAGATTGCTTTAAGTTGTGTTCTTTATGGCCAGAGGGCCATATATTTAATCAACGGAAATTAGTAGACTTCTGGATAGGGTCAGGATTAATACAAGGGGATGACATTGAAGCGTCTTACAACGAAGGTTTCTCTCATATTACCACCTTGCAAGAATTTTGCCTTTTAGAGCCAGCAGAAGATGGAGAGGCAGTGCAAATGCAATCTACAATCCGTGATTTTGCCTTATGGGTTGTACACAGTCAAGGCGAGGACAAGAACAAATGGAGAATCCAAACCAAAGAGAATTGGGGATTGGCAGAGCAAGTTCTATTAGTGGGGCTTAAAATTACAGAACTGCCTCGTATTCCTAGCAATCAAAAAACCCTTGAAGTCTTGATACTCCAGCACAATTATTTGGAAGACGGTTCTTTCGGGAACTTCCCCTCGTTGCTTTCACTGCAGTACCTAGATCTCTCTTTTAATAAATTGTCCAATATACCTGTAGAGATTTGCATGCAGGTCAACCTAAGATATCTGAATTTGTCAAATAACAGAATAAAAACGGTACCAGTGGAGTTAGGCTGTCTTACCAGACTGAGGCACTTGCATCTTCGGAATAATCCAAATCTAGTTATTCCAAATGGTATACTACCAAAACTCCAGAATTTGGAGGTGCTGGATGTTTGCTCATTTAATTTACTGCAGTGCTCATCCTATGAGGCGCCAATTAATGAGCTTGTGCGTATGGATAAATTGCAGTCCCTTGGAATTACTGTTCGTTCAGAAACCTCGTTTCAAGGGATTAGTAAGACAACCTTACCAATACGGTCCCTCTCTATTGTCATTTATAACCATGAAGATGGGTATGAGACTCATGTATCTTCTGAAAATTCTTGTATCAATCCTGAAAGACAAACAAACCTGTTTGAACTTGGTATTTACACAAGACAAAAGACTATTGTGCTTGACAGCATTCATTCAATGTGGAATGTTCAGCATGTTGAGAAAGCATACCTCCATGGTTATTTCGTTGATAGGATCATATGCCAGAAGCTGCACACTGGAGATATTTTTGCAAAACTCAGACGTTTGGATATAGTACGGTGTTCAAGATTGAATCATATTTCATGGATTATTCATCTCCCGCTTCTAGAGGATTTGCTGCTATTTTCATGTTCAACATTGCACCAGATTATTGCTACTGCACAAGATGGTGTCGTTAAGACAAATCAGGAAAAGGAAAATCCATCAGTTAATAATACATTCCCCAGTCTTAAAAGGATGACACTGATCGAAGCTGGTGCATTGGTTAGGATCTGCAGCCCGTTCTTCTCATTTCCTTCTCTGGAATGCCTTCAGATCTCTGCATGCCCTTTGTTGAATAAACTTCCCTTTCTTACCGTTCCGAGCAAACTGAAATGTATACGCGGTGAGAATGAATGGTGGGATGGTTTGGAATGGGAAGACCAAGATCTTGAACCTTCACTTGAACTTTACTTTCATGGCCTCTCTGCTGAAGATCAACTATCTGAATTGTATCTTTTCAATAGCCTGGAAGTGGAATGGGCTAGTATCTTTACCCCTTGATGAAAGAAGCAACTGCTGGTGGTGACAATGCATCTTCATCTACACATGCTGCGAAACCAGCGAGCGAACCTTCCAAAACGAGGCCCACAACACCAACGATATCTTGCTTTGCATCAGGCCATTCCCAATCCAATGACTAGGATGGTGTCCATAACATTAAATAAGATGCCACATAGGATGAAAAATTATGTGGCAAGTGAATAAATGAGGAAAGAGAAGGAAACCATGTCTTGCATGAGACATGGTTTCTACACAATATCCAAGACATCATGTGAGATAAGAAGCATTAAATTTAAGTATGGAATAGTAGTGTTTACATTGG


Protein sequences

Name Description Sequence
Os.85201 translated coding region predicted by ESTScan from UniGene Os.85201

ESWRFRGLTLEKPRRRPLHGDSIXRRDDHMEHGARASSTDSNGEEPGLFRRRSIPRPPWRVRAPGARQGLRAHEGPRGGAAGQEAGDGGSLDRGGGDLPPPVRRAAERARPDPQAHLLGSARLLPRQQGRVADDAAGEEAVRRRGKDRAQEQAAPTDGDLHGVREQGSYPPGRDREGEEIQPNGIVAIWGRAGLGKTYLLKLVEEYFSRDDTFDLVLRIASPRDSSVAKVLSIHAYXFIASSITLGYSVFFLRGRIFSXGIYKMKRNSTSTNIXFFLANVXYFALDMLLTTIAWTDINNLALSFHIHHKMHFXHVTLGHFQVQSEIAKKLMLANCDGMQHRARIFDFLKERNFLLLLDCVWQRLDLEEVGIPSLDLVGSCYNRRVVFTACSSHVCDQMNVEVENRIEVHCLDHTESWEIFKQNADLDYLGHKHVYLPRNISAELLGSPLELVTIGKAMHNKKDAIYWQNALHYLTESCLRDTQWSGSEEATFFRLKLAYDSLTGILKDCFKLCSLWPEGHIFNQRKLVDFWIGSGLIQGDDIEASYNEGFSHITTLQEFCLLEPAEDGEAVQMQSTIRDFALWVVHSQGEDKNKWRIQTKENWGLAEQVLLVGLKITELPRIPSNQKTLEVLILQHNYLEDGSFGNFPSLLSLQYLDLSFNKLSNIPVEICMQVNLRYLNLSNNRIKTVPVELGCLTRLRHLHLRNNPNLVIPNGILPKLQNLEVLDVCSFNLLQCSSYEAPINELVRMDKLQSLGITVRSETSFQGISKTTLPIRSLSIVIYNHEDGYETHVSSENSCINPERQTNLFELGIYTRQKTIVLDSIHSMWNVQHVEKAYLHGYFVDRIICQKLHTGDIFAKLRRLDIVRCSRLNHISWIIHLPLLEDLLLFSCSTLHQIIATAQDGVVKTNQEKENPSVNNTFPSLKRMTLIEAGALVRICSPFFSFPSLECLQISACPLLNKLPFLTVPSKLKCIRGENEWWDGLEWEDQDLEPSLELYFHGLSAEDQLSELYLFNSLEVEWASIFTPXXKKQLLVVTMHLHLHMLRNQRANLPKRGPQHQRYLALHQAIPNPMTRMVSITLNKMPHRMKNYVASEXMRKEKETMSCMRHGFYTISKTSCEIRSIKFKYGIVVFTLX

Domains

Domain Start-End Description Sequence

Seg: seg
78-115 seg

GGAAGQEAGDGGSLDRGGGDLPPPVRRAAERARPDPQA

superfamily: SSF52540
153-482 P-loop containing nucleoside triphosphate hydrolases

AAPTDGDLHGVREQGSYPPGRDREGEEIQPNGIVAIWGRAGLGKTYLLKLVEEYFSRDDTFDLVLRIASPRDSSVAKVLSIHAYXFIASSITLGYSVFFLRGRIFSXGIYKMKRNSTSTNIXFFLANVXYFALDMLLTTIAWTDINNLALSFHIHHKMHFXHVTLGHFQVQSEIAKKLMLANCDGMQHRARIFDFLKERNFLLLLDCVWQRLDLEEVGIPSLDLVGSCYNRRVVFTACSSHVCDQMNVEVENRIEVHCLDHTESWEIFKQNADLDYLGHKHVYLPRNISAELLGSPLELVTIGKAMHNKKDAIYWQNALHYLTESCLRDT

FPrintScan: PR00364
IPR000767
185-200 DISEASERSIST
Disease resistance protein

IVAIWGRAGLGKTYLL

HMMPfam: PF00931
IPR002182
319-541 NB-ARC,NBS
NB-ARC

HFQVQSEIAKKLMLANCDGMQHRARIFDFLKERNFLLLLDCVWQRLDLEEVGIPSLDLVGSCYNRRVVFTACSSHVCDQMNVEVENRIEVHCLDHTESWEIFKQNADLDYLGHKHVYLPRNISAELLGSPLELVTIGKAMHNKKDAIYWQNALHYLTESCLRDTQWSGSEEATFFRLKLAYDSLTGILKDCFKLCSLWPEGHIFNQRKLVDFWIGSGLIQGDD

superfamily: SSF52058
324-969 L domain-like,LRR

SEIAKKLMLANCDGMQHRARIFDFLKERNFLLLLDCVWQRLDLEEVGIPSLDLVGSCYNRRVVFTACSSHVCDQMNVEVENRIEVHCLDHTESWEIFKQNADLDYLGHKHVYLPRNISAELLGSPLELVTIGKAMHNKKDAIYWQNALHYLTESCLRDTQWSGSEEATFFRLKLAYDSLTGILKDCFKLCSLWPEGHIFNQRKLVDFWIGSGLIQGDDIEASYNEGFSHITTLQEFCLLEPAEDGEAVQMQSTIRDFALWVVHSQGEDKNKWRIQTKENWGLAEQVLLVGLKITELPRIPSNQKTLEVLILQHNYLEDGSFGNFPSLLSLQYLDLSFNKLSNIPVEICMQVNLRYLNLSNNRIKTVPVELGCLTRLRHLHLRNNPNLVIPNGILPKLQNLEVLDVCSFNLLQCSSYEAPINELVRMDKLQSLGITVRSETSFQGISKTTLPIRSLSIVIYNHEDGYETHVSSENSCINPERQTNLFELGIYTRQKTIVLDSIHSMWNVQHVEKAYLHGYFVDRIICQKLHTGDIFAKLRRLDIVRCSRLNHISWIIHLPLLEDLLLFSCSTLHQIIATAQDGVVKTNQEKENPSVNNTFPSLKRMTLIEAGALVRICSPFFSFPSLECLQISACPLLNKLPFLTVP

FPrintScan: PR00364
IPR000767
444-458 DISEASERSIST
Disease resistance protein

LLGSPLELVTIGKAM

HMMPanther: PTHR23155
615-965 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KITELPRIPSNQKTLEVLILQHNYLEDGSFGNFPSLLSLQYLDLSFNKLSNIPVEICMQVNLRYLNLSNNRIKTVPVELGCLTRLRHLHLRNNPNLVIPNGILPKLQNLEVLDVCSFNLLQCSSYEAPINELVRMDKLQSLGITVRSETSFQGISKTTLPIRSLSIVIYNHEDGYETHVSSENSCINPERQTNLFELGIYTRQKTIVLDSIHSMWNVQHVEKAYLHGYFVDRIICQKLHTGDIFAKLRRLDIVRCSRLNHISWIIHLPLLEDLLLFSCSTLHQIIATAQDGVVKTNQEKENPSVNNTFPSLKRMTLIEAGALVRICSPFFSFPSLECLQISACPLLNKLPF

ProfileScan: PS51450
IPR001611
628-651 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLEVLILQHNYLEDGSFGNFPSLL

HMMSmart: SM00369
IPR003591
650-673 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LLSLQYLDLSFNKLSNIPVEICMQ

ProfileScan: PS51450
IPR001611
652-673 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQYLDLSFNKLSNIPVEICMQ

HMMPfam: PF13855
652-707 LRR_8,Leucine rich repeat

SLQYLDLSFNKLSNIPVEICMQVNLRYLNLSNNRIKTVPVELGCLTRLRHLHLRNN

HMMSmart: SM00369
IPR003591
674-695 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

VNLRYLNLSNNRIKTVPVELGC

ProfileScan: PS51450
IPR001611
675-696 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRYLNLSNNRIKTVPVELGCL

Seg: seg
696-710 seg

LTRLRHLHLRNNPNL

HMMSmart: SM00369
IPR003591
696-719 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTRLRHLHLRNNPNLVIPNGILPK

ProfileScan: PS51450
IPR001611
698-719 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLRHLHLRNNPNLVIPNGILPK

FPrintScan: PR00364
IPR000767
718-734 DISEASERSIST
Disease resistance protein

PKLQNLEVLDVCSFNLL

Gene3D: G3DSA:3.80.10.10
859-982 no description

AKLRRLDIVRCSRLNHISWIIHLPLLEDLLLFSCSTLHQIIATAQDGVVKTNQEKENPSVNNTFPSLKRMTLIEAGALVRICSPFFSFPSLECLQISACPLLNKLPFLTVPSKLKCIRGENEWW

Seg: seg
881-889 seg

LPLLEDLLL

Seg: seg
1034-1046 seg

LLVVTMHLHLHML






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox