PRGDB00073190 (Os.85279)

From PRG Wiki
Jump to: navigation, search
Os.85279
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 297728668 (NM_001189769)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group Os11g0664000 (Os11g0664000) mRNA, partial cds

DNA Sequence

CTGAGGATCAAGTCTTCAAGACGAGGCAGCCGTCCTCTGCATTTCATCTTTGTCGATCCGTTTGTTAGAAACAAAGAACAGAATCCTTATATGTCTTAGTGCCATGGCACTGTGGAGCGGGCTGGGGCAGGCGGCGACGGTGGCGCAACTGGTTGGTGCGGACGTCGGCGGGCTCATCTCCATGATCATGCAGGCGGCGATGACGGCTCAGCAGAACAAGAAGGAGTGCGAGCAGCTCGCCCGCCGCGTCTTCACCATCGCCGAGCTGCTGCAGCACCTGCAGGATCCCGATTTGCTGCGGCGGCCTGAGATCCGGCGGCCGCTGACCGGGCTCGACGACACGCTTCGGGAGGCACACGAGCTTGTGTTGTCGTGCCAGGACAAGAGCGCCGTGTACCAGTTGGTGATGGCAAGGAGGCAGGCTGACCGGTTCAGAGATGTGCAGAGCAGGATCGACTCCTATCTCCTCCTCGTCCCCGTTATCAGCCTCCTGGATATCACTCGTCGTCTCGATCGTATCTACAACATACTGCTTCCAACCAACACGCCCGGACCATCTATGCCTGCTTTCTCCGTGCCCCCAAATCCATCCCCTCCCGCTCAGGTACACATTGAAGTGGGAAGACTCAACTCTCAAGCATTCAATTGTATACTTGTAGTACTATCTATACTATTCTACTGCAACTCTTTTGATTTGGTATTCAGTTCCTCTTTCTTTCCGTTGTGTTCATCGCTATACTAGGTTGCCACACAGTTTGTTTGGAGAGGAACCCATGGAGTCAAAGAATTCACTTTTAAGGAGCTCACAACGGCGACGAACAACTTTTCTCTTGACAGAAAGATTGGTCAAGGCGCCTTCGCTACGGTGTACATGGGTAGGCTTCCCGACGGACGCGAGGTGGCCATCGAACGCACGCTCGAAACATCCGGCATAGGGAAAATAGACATCATGAGAGAGCTCAGTATCCTCCGCTCCATTAGCCACCAGCACATCGTCCGCGTCTTTGGCAGCTGTGTGAAGGAGAAGCGCCAGCTCCTGCCACCGTTTCGGAAAAAGGAGGAAGAGATCCTACTCGTCCTCGAGTATATTGAGAACGACACCCTTGACAAACACCTGCACGGCCCACGGTCGTCGTCGCCGGTGATGACGTCCTGGAAGACGCGCATCGAGATACTGCTAGGTGTGTCGAGGGCCATCGAGTACATGCAGTCCTACGGTGAGCGGCCGGTGATCCACCGTGACGTCAAGCCGTCCAACATCCTGCTCGATGCGAGCTGGGCGCCGCACTTGACGGACTTCCTTTGGGCGCTCACATGGGAAGGCCCAGGCCATCAGGAGAATATTATTGGCACCTATGGATACTTGGCCCCGGAGTGCGTTATAGCAGGCACTCTAAACCCGACAGTCGATGTCTACAGTTTGGGTGTTGTGATGCTGGAGGTATTGACGGGGAAGAAACCATATTTCTCTAAAGAAGAATGGGAAAAGGAGAAGACAGAAGAACGTGTGGAAGAGGAGAAGAGAGAAGAATGTGAGCAAGAGGGGAAGAACACAGAAGAGGGCAAGGAGAGTGAACGAGAAGAAGATGGGAAGACAAAAGAAGAATGGCATGAATGGCGAAAGCGGGAAATGTTTAGTCGTCGCCACAACTTGGTGTCCTTCGCGCTGCCACTGATCGAGGCGGGGGAGGTGTGGAAGGTGCTGGACAAGCGGCCGGCAGCGGAGCCAACGCCGAGGCAGCTGGAGGCAGCGGAACTGGTGGCGCAGATGGCAGTACGCTGCCTGCTGCTGCAGTGGGAGGAGCGGCCGCCCATTTCGGAAGTCGTGGCCAACCTCGAGAACGCGCTCGAGCTCGCCCATTGCGACGGTTAGCATAGCCTGGGCTCCCGAGACATCCTATGTGAATTGGGCAATGTATTTCTCATGTAAAAATTAATGCTGTTTGCTTCTGTTTCTCTTTTGTGAGCATACACAATTAAACATCGG


Protein sequences

Name Description Sequence
Os.85279 translated coding region predicted by ESTScan from UniGene Os.85279

MALWSGLGQAATVAQLVGADVGGLISMIMQAAMTAQQNKKECEQLARRVFTIAELLQHLQDPDLLRRPEIRRPLTGLDDTLREAHELVLSCQDKSAVYQLVMARRQADRFRDVQSRIDSYLLLVPVISLLDITRRLDRIYNILLPTNTPGPSMPAFSVPPNPSPPAQVHIEVGRLNSQAFNCILVVLSILFYCNSFDLVFSSSFFPLCSSLYXVATQFVWRGTHGVKEFTFKELTTATNNFSLDRKIGQGAFATVYMGRLPDGREVAIERTLETSGIGKIDIMRELSILRSISHQHIVRVFGSCVKEKRQLLPPFRKKEEEILLVLEYIENDTLDKHLHGPRSSSPVMTSWKTRIEILLGVSRAIEYMQSYGERPVIHRDVKPSNILLDASWAPHLTDFLWALTWEGPGHQENIIGTYGYLAPECVIAGTLNPTVDVYSLGVVMLEVLTGKKPYFSKEEWEKEKTEERVEEEKREECEQEGKNTEEGKESEREEDGKTKEEWHEWRKREMFSRRHNLVSFAAATDRGGGGVEGAGQAAGSGANAEAAGGSGTGGADGSTLPAAAVGGAAAHFGSRGQPRERARAXPIATVSIAWAPETSYVNWAMYFSCKN

Domains

Domain Start-End Description Sequence

Seg: seg
154-166 seg

PAFSVPPNPSPPA

Seg: seg
198-211 seg

LVFSSSFFPLCSSL

superfamily: SSF56112
IPR011009
213-461 Protein kinase-like (PK-like)
Protein kinase-like domain

XVATQFVWRGTHGVKEFTFKELTTATNNFSLDRKIGQGAFATVYMGRLPDGREVAIERTLETSGIGKIDIMRELSILRSISHQHIVRVFGSCVKEKRQLLPPFRKKEEEILLVLEYIENDTLDKHLHGPRSSSPVMTSWKTRIEILLGVSRAIEYMQSYGERPVIHRDVKPSNILLDASWAPHLTDFLWALTWEGPGHQENIIGTYGYLAPECVIAGTLNPTVDVYSLGVVMLEVLTGKKPYFSKEEWE

HMMPanther: PTHR24420:SF877
220-464 OS11G0666200 PROTEIN

WRGTHGVKEFTFKELTTATNNFSLDRKIGQGAFATVYMGRLPDGREVAIERTLETSGIGKIDIMRELSILRSISHQHIVRVFGSCVKEKRQLLPPFRKKEEEILLVLEYIENDTLDKHLHGPRSSSPVMTSWKTRIEILLGVSRAIEYMQSYGERPVIHRDVKPSNILLDASWAPHLTDFLWALTWEGPGHQENIIGTYGYLAPECVIAGTLNPTVDVYSLGVVMLEVLTGKKPYFSKEEWEKEK

HMMPanther: PTHR24420
220-464 FAMILY NOT NAMED,FAMILY NOT NAMED

WRGTHGVKEFTFKELTTATNNFSLDRKIGQGAFATVYMGRLPDGREVAIERTLETSGIGKIDIMRELSILRSISHQHIVRVFGSCVKEKRQLLPPFRKKEEEILLVLEYIENDTLDKHLHGPRSSSPVMTSWKTRIEILLGVSRAIEYMQSYGERPVIHRDVKPSNILLDASWAPHLTDFLWALTWEGPGHQENIIGTYGYLAPECVIAGTLNPTVDVYSLGVVMLEVLTGKKPYFSKEEWEKEK

Gene3D: G3DSA:3.30.200.20
223-323 no description

THGVKEFTFKELTTATNNFSLDRKIGQGAFATVYMGRLPDGREVAIERTLETSGIGKIDIMRELSILRSISHQHIVRVFGSCVKEKRQLLPPFRKKEEEIL

ProfileScan: PS50011
IPR000719
241-506 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSLDRKIGQGAFATVYMGRLPDGREVAIERTLETSGIGKIDIMRELSILRSISHQHIVRVFGSCVKEKRQLLPPFRKKEEEILLVLEYIENDTLDKHLHGPRSSSPVMTSWKTRIEILLGVSRAIEYMQSYGERPVIHRDVKPSNILLDASWAPHLTDFLWALTWEGPGHQENIIGTYGYLAPECVIAGTLNPTVDVYSLGVVMLEVLTGKKPYFSKEEWEKEKTEERVEEEKREECEQEGKNTEEGKESEREEDGKTKEEWHEWR

HMMSmart: SM00219
IPR020635
241-518 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSLDRKIGQGAFATVYMGRLPDGREVAIERTLETSGIGKIDIMRELSILRSISHQHIVRVFGSCVKEKRQLLPPFRKKEEEILLVLEYIENDTLDKHLHGPRSSSPVMTSWKTRIEILLGVSRAIEYMQSYGERPVIHRDVKPSNILLDASWAPHLTDFLWALTWEGPGHQENIIGTYGYLAPECVIAGTLNPTVDVYSLGVVMLEVLTGKKPYFSKEEWEKEKTEERVEEEKREECEQEGKNTEEGKESEREEDGKTKEEWHEWRKREMFSRRHNLV

HMMSmart: SM00220
IPR002290
241-518 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSLDRKIGQGAFATVYMGRLPDGREVAIERTLETSGIGKIDIMRELSILRSISHQHIVRVFGSCVKEKRQLLPPFRKKEEEILLVLEYIENDTLDKHLHGPRSSSPVMTSWKTRIEILLGVSRAIEYMQSYGERPVIHRDVKPSNILLDASWAPHLTDFLWALTWEGPGHQENIIGTYGYLAPECVIAGTLNPTVDVYSLGVVMLEVLTGKKPYFSKEEWEKEKTEERVEEEKREECEQEGKNTEEGKESEREEDGKTKEEWHEWRKREMFSRRHNLV

HMMPfam: PF00069
IPR017442
242-485 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

SLDRKIGQGAFATVYMGRLPDGREVAIERTLETSGIGKIDIMRELSILRSISHQHIVRVFGSCVKEKRQLLPPFRKKEEEILLVLEYIENDTLDKHLHGPRSSSPVMTSWKTRIEILLGVSRAIEYMQSYGERPVIHRDVKPSNILLDASWAPHLTDFLWALTWEGPGHQENIIGTYGYLAPECVIAGTLNPTVDVYSLGVVMLEVLTGKKPYFSKEEWEKEKTEERVEEEKREECEQEGKNTE

Seg: seg
319-330 seg

EEEILLVLEYIE

Gene3D: G3DSA:1.10.510.10
324-504 no description

LVLEYIENDTLDKHLHGPRSSSPVMTSWKTRIEILLGVSRAIEYMQSYGERPVIHRDVKPSNILLDASWAPHLTDFLWALTWEGPGHQENIIGTYGYLAPECVIAGTLNPTVDVYSLGVVMLEVLTGKKPYFSKEEWEKEKTEERVEEEKREECEQEGKNTEEGKESEREEDGKTKEEWHE

PatternScan: PS00108
IPR008271
376-388 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDVKPSNILL

Coil: coil
455-495 coiled-coil

FSKEEWEKEKTEERVEEEKREECEQEGKNTEEGKESEREED

Seg: seg
457-482 seg

KEEWEKEKTEERVEEEKREECEQEGK

Seg: seg
485-494 seg

EEGKESEREE

Seg: seg
522-557 seg

AATDRGGGGVEGAGQAAGSGANAEAAGGSGTGGADG

Seg: seg
562-570 seg

AAAVGGAAA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox