PRGDB00073196 (Os.85974)

From PRG Wiki
Jump to: navigation, search
Os.85974
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 297722272 (NM_001186571)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group Os03g0566700 (Os03g0566700) mRNA, complete cds

DNA Sequence

ATGGACATGTCCAGTTACCTAGCTGTAGGTGGCTGGTTCATCCAGGTCATTTTTGACAAGTATCTGTCCTACCAGCTTCAGAGCTGGGCGGCCGACTGCGGCATCAGCCATGAGATGAACAGACTTCGTGTCGCGCTGCTTCGCACGCAGTCTGTCCTCCATGGGGCAGAGGTAACACCTTCACTGTCTTACGGCTCCCTCCCATGGATGCGGGAGCTCCGGGATGTCATGTACCATGCAGAGGACCTCCTAGACAAGCTTGAGTACAACCGCCTCCATCATCAAATGCAGGAATCAAGTTCAACAGAGAGCAACAGTAGCCCAATCAGCGCCTTTATGCATTCCAGGTTTCGCAATCAAGGGGCCCAAGCTTCTGGTCTAGAGCCACACTGGGATAGATCAACCAGGGTCAAGAATCAGATGGTAAATCTGTTGGAGCGCCTTGAGCAGGTTGCTAGTGGAGTCAGTGAAGCACTCAGTCTACCAAGGAAGCCCAGGCACAGCAGATACAGCATCATGACAAGCTCAGTTGCCCATGGGGAAATCTTCGGGCGAGAATCAGAAATCCAACAGTTGGTAAGTACTCTTTTAAGCTCTCAGGTTGATGGTGATAATCCAGTCTCGGTTGCCTCCATTGTTGGAGTTGGTGGCGTTGGCAAGACTGCTCTAGCACAGCATGTGTACAACAACACTAGAGTAGCACAGTACTTTGACATGAGAATGTGGATCTGTGTTACTGATGCCTTTGATGAGTCCAGGATCACAAGAGAGATGCTAGAGTCAGTTTCCAGCAGTCGATTTAGGCATGACAGCATAACAAATTTCAACAGGCTTCAGGTGGCACTGCGAGCAAGGCTCGTATCCAAACGGTTTCTGCTTGTCTTAGATGATGTCTGGAGCAATGACAAGATAACTCTGGCGATAGAGCACGAGAACTGGCAGAAGCTTCTTTCTCCCCTAAAGGCTGCAGCAAATGGGAGCAAGATACTTCTGACCACCCGATCCAGTATGGTGGCGGAGATGCTACAGTCAGCCCATATAACTAACCTGGAGTGCTTGTCAGATAAGGATTGCTGGTCCCTGATAAAAATGATTGTGTTTGATGATACGAACCATCTTATAAATTCACAGTTGGCGAATATTGGGAGCGAGATTGCTAAGACACTTAATGGTCTACCTCTTGCCGCAAAGGTGGTCGCTAGACAGCTGAAATGTAAACACACCACAGATGAGTGGAAACAAGTCTTACAGAGAAATGCAGTATGGGATGAAATCATGCCAATTTTTCAGCATAGCTATGAGAATCTCCCAGTGCACCTTCAACAATGCCTTGCATATTGCAGTATCTTCCCCAAGGACTGGGAATTTGAAGCTGAGCAGTTGATCCTCATGTGGATGGCACAAGGTTATGTATACCCAGATGGTTGCAGGAGAATGGAAGACATTGGGAAGCAATATGTTGATGAGTTATGTAGTCGGTCATTTTTTGCCATTCAGAAGAAACAATTTGTCAGCTATTATGTGATGCCTCCCGTTATTCACAAACTTGCCAAATCAGTTTCAGCCGAAGAATGTTTCCGAATAGGAGGTGATGAACAGAGAAGGATCCCATCCTCTGTACGCCATCTATCAATCCATCTAGATAGCCTTTCAATGCTTGACGAGACAATACCATACATGAACCTGCGCACTCTCATTTTCTTTACGAGCAGAATGGTGGCTCCAATCAACATTTCCATCCCACAAGTAGTTCTTGATAACCTTCAAAGCCTTCGTGTCTTGGATTTATCACCTTGCAAGATTGACAGACTTCCTGACAGTATACGACAGTGTGTGCATCTCCGATACCTAAATATCTCATCAACTGCCATCAACATGTTACCAGAATACTTGGGTAAACTTTACCACTTGCAAGTTCTAAACTTATCAGGCTGCAGGCTTGAAAAGTTACCTTCAAGCATAAACAACCTGGTCAGTTTACGGCATCTGACAGCAGCTAACCAGATTCTTTCCACTATAACAGACATAGGAAGCCTAAGATACCTTCAGAGATTGCCCATTTTCAAGGTCACCAGTGAGGAAACAAACAGCATAATTCAGCTTGGTTATCTACAAGAGCTTCGTGGATCCCTCCACATTAGGAACCTTGAGAACATTGATGCTCCTGATGAGGCAAAGGAAGCCATGTTGTGTAAGAAAGTAAACCTGACAATGCTGCAGCTGATGTGGGCACCTGCTCGAGATTTGGTAAACTCAGATAAGGAAGCAGAGGTGTTAGAGTATCTCCAGCCACACCCAAATCTGAAGAGGCTGGACATCATCGGTTGGATGGGAGTCAAAGCCCCCAGTTGGCTTGAAAGCAAATGGCTAATCAATCTTGAGCTCATCTTCCTCAGTGGTTGCAATGCTTGGGAGCAGCTTCCACCACTTGGTCAGCTTCCATCTGTCAGGACTATTTGGTTGCAGCGTTTGAAAACAGTGAGGCAAATAGGCCTAGAGGTATATGGCAATAGAAGTTCACATGTGGCTTTCCAGTCATTAGAGGAGCTAGTTCTTGATGACATGCAAGAACTAAATGAGTGGTCATGGACAGGCCAGGAAATGATGAATCTCCGCAATATTGTGATTAAGGACTGCCAAAAGCTCAAAGAGCTGCCTCCACTACCTCCAAGCCTTACAGAGCTGACAATTGCAAAAAAAGGGTTCTGGGTTCCATACCATCATGATGTGAAGATGACACAATTGACCACTGTCACCACTGTCTCATCTCTCTGCATATTCAATTGCCCCAAGCTACTTGCCAGATTTTCCTCGCCAGTGACCAATGGAGTTGTAGCAAGCTTTCAGTCACTTAGAAGCCTTATCGTTGATCATATGAGAATACTCACATGCCCTCTTTTAAGGGAAAGGCTTGAGCACATTGAGAACCTAGACATCCAAGATTGCTCAGAGATCACCACCTTCACTGCAGACAATGAGGATGTCTTCCTACATCTAAGATCACTACAAAGCCTCTGCATAAGTGGCTGCAACAATCTACAATCGCTGCCTTCCTCATTGTCCAGCCTGGAGTCCCTGGATAAATTAATCTTGTGGAATTGCCCTGAGTTGGAATTACTCCCAGACGAGCAGCTGCCACTGTCTCTTAGAAAGCTTGAAGTCGCACTCTGTAACCCAGTGCTCAAGGATAGACTCAGAAAAGAATGTGGCATTGACTGGCCAAAGATTGCGCATATCCCTTGGGTTGAGATAGATGGTGAAATTCTGCAGTGA


Protein sequences

Name Description Sequence
Os.85974 translated coding region predicted by ESTScan from UniGene Os.85974

MDMSSYLAVGGWFIQVIFDKYLSYQLQSWAADCGISHEMNRLRVALLRTQSVLHGAEVTPSLSYGSLPWMRELRDVMYHAEDLLDKLEYNRLHHQMQESSSTESNSSPISAFMHSRFRNQGAQASGLEPHWDRSTRVKNQMVNLLERLEQVASGVSEALSLPRKPRHSRYSIMTSSVAHGEIFGRESEIQQLVSTLLSSQVDGDNPVSVASIVGVGGVGKTALAQHVYNNTRVAQYFDMRMWICVTDAFDESRITREMLESVSSSRFRHDSITNFNRLQVALRARLVSKRFLLVLDDVWSNDKITLAIEHENWQKLLSPLKAAANGSKILLTTRSSMVAEMLQSAHITNLECLSDKDCWSLIKMIVFDDTNHLINSQLANIGSEIAKTLNGLPLAAKVVARQLKCKHTTDEWKQVLQRNAVWDEIMPIFQHSYENLPVHLQQCLAYCSIFPKDWEFEAEQLILMWMAQGYVYPDGCRRMEDIGKQYVDELCSRSFFAIQKKQFVSYYVMPPVIHKLAKSVSAEECFRIGGDEQRRIPSSVRHLSIHLDSLSMLDETIPYMNLRTLIFFTSRMVAPINISIPQVVLDNLQSLRVLDLSPCKIDRLPDSIRQCVHLRYLNISSTAINMLPEYLGKLYHLQVLNLSGCRLEKLPSSINNLVSLRHLTAANQILSTITDIGSLRYLQRLPIFKVTSEETNSIIQLGYLQELRGSLHIRNLENIDAPDEAKEAMLCKKVNLTMLQLMWAPARDLVNSDKEAEVLEYLQPHPNLKRLDIIGWMGVKAPSWLESKWLINLELIFLSGCNAWEQLPPLGQLPSVRTIWLQRLKTVRQIGLEVYGNRSSHVAFQSLEELVLDDMQELNEWSWTGQEMMNLRNIVIKDCQKLKELPPLPPSLTELTIAKKGFWVPYHHDVKMTQLTTVTTVSSLCIFNCPKLLARFSSPVTNGVVASFQSLRSLIVDHMRILTCPLLRERLEHIENLDIQDCSEITTFTADNEDVFLHLRSLQSLCISGCNNLQSLPSSLSSLESLDKLILWNCPELELLPDEQLPLSLRKLEVALCNPVLKDRLRKECGIDWPKIAHIPWVEIDGEILQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
69-897 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

WMRELRDVMYHAEDLLDKLEYNRLHHQMQESSSTESNSSPISAFMHSRFRNQGAQASGLEPHWDRSTRVKNQMVNLLERLEQVASGVSEALSLPRKPRHSRYSIMTSSVAHGEIFGRESEIQQLVSTLLSSQVDGDNPVSVASIVGVGGVGKTALAQHVYNNTRVAQYFDMRMWICVTDAFDESRITREMLESVSSSRFRHDSITNFNRLQVALRARLVSKRFLLVLDDVWSNDKITLAIEHENWQKLLSPLKAAANGSKILLTTRSSMVAEMLQSAHITNLECLSDKDCWSLIKMIVFDDTNHLINSQLANIGSEIAKTLNGLPLAAKVVARQLKCKHTTDEWKQVLQRNAVWDEIMPIFQHSYENLPVHLQQCLAYCSIFPKDWEFEAEQLILMWMAQGYVYPDGCRRMEDIGKQYVDELCSRSFFAIQKKQFVSYYVMPPVIHKLAKSVSAEECFRIGGDEQRRIPSSVRHLSIHLDSLSMLDETIPYMNLRTLIFFTSRMVAPINISIPQVVLDNLQSLRVLDLSPCKIDRLPDSIRQCVHLRYLNISSTAINMLPEYLGKLYHLQVLNLSGCRLEKLPSSINNLVSLRHLTAANQILSTITDIGSLRYLQRLPIFKVTSEETNSIIQLGYLQELRGSLHIRNLENIDAPDEAKEAMLCKKVNLTMLQLMWAPARDLVNSDKEAEVLEYLQPHPNLKRLDIIGWMGVKAPSWLESKWLINLELIFLSGCNAWEQLPPLGQLPSVRTIWLQRLKTVRQIGLEVYGNRSSHVAFQSLEELVLDDMQELNEWSWTGQEMMNLRNIVIKDCQKLKELPPLPPSLTELTI

Seg: seg
99-110 seg

SSSTESNSSPIS

superfamily: SSF52540
165-418 P-loop containing nucleoside triphosphate hydrolases

PRHSRYSIMTSSVAHGEIFGRESEIQQLVSTLLSSQVDGDNPVSVASIVGVGGVGKTALAQHVYNNTRVAQYFDMRMWICVTDAFDESRITREMLESVSSSRFRHDSITNFNRLQVALRARLVSKRFLLVLDDVWSNDKITLAIEHENWQKLLSPLKAAANGSKILLTTRSSMVAEMLQSAHITNLECLSDKDCWSLIKMIVFDDTNHLINSQLANIGSEIAKTLNGLPLAAKVVARQLKCKHTTDEWKQVLQR

Gene3D: G3DSA:3.40.50.300
183-341 no description

FGRESEIQQLVSTLLSSQVDGDNPVSVASIVGVGGVGKTALAQHVYNNTRVAQYFDMRMWICVTDAFDESRITREMLESVSSSRFRHDSITNFNRLQVALRARLVSKRFLLVLDDVWSNDKITLAIEHENWQKLLSPLKAAANGSKILLTTRSSMVAEM

HMMPfam: PF00931
IPR002182
185-472 NB-ARC,NBS
NB-ARC

RESEIQQLVSTLLSSQVDGDNPVSVASIVGVGGVGKTALAQHVYNNTRVAQYFDMRMWICVTDAFDESRITREMLESVSSSRFRHDSITNFNRLQVALRARLVSKRFLLVLDDVWSNDKITLAIEHENWQKLLSPLKAAANGSKILLTTRSSMVAEMLQSAHITNLECLSDKDCWSLIKMIVFDDTNHLINSQLANIGSEIAKTLNGLPLAAKVVARQLKCKHTTDEWKQVLQRNAVWDEIMPIFQHSYENLPVHLQQCLAYCSIFPKDWEFEAEQLILMWMAQGYVY

FPrintScan: PR00364
IPR000767
209-224 DISEASERSIST
Disease resistance protein

VASIVGVGGVGKTALA

Seg: seg
213-219 seg

VGVGGVG

FPrintScan: PR00364
IPR000767
285-299 DISEASERSIST
Disease resistance protein

RLVSKRFLLVLDDVW

FPrintScan: PR00364
IPR000767
389-403 DISEASERSIST
Disease resistance protein

LNGLPLAAKVVARQL

superfamily: SSF52058
508-932 L domain-like,LRR

VMPPVIHKLAKSVSAEECFRIGGDEQRRIPSSVRHLSIHLDSLSMLDETIPYMNLRTLIFFTSRMVAPINISIPQVVLDNLQSLRVLDLSPCKIDRLPDSIRQCVHLRYLNISSTAINMLPEYLGKLYHLQVLNLSGCRLEKLPSSINNLVSLRHLTAANQILSTITDIGSLRYLQRLPIFKVTSEETNSIIQLGYLQELRGSLHIRNLENIDAPDEAKEAMLCKKVNLTMLQLMWAPARDLVNSDKEAEVLEYLQPHPNLKRLDIIGWMGVKAPSWLESKWLINLELIFLSGCNAWEQLPPLGQLPSVRTIWLQRLKTVRQIGLEVYGNRSSHVAFQSLEELVLDDMQELNEWSWTGQEMMNLRNIVIKDCQKLKELPPLPPSLTELTIAKKGFWVPYHHDVKMTQLTTVTTVSSLCIFNCPKL

Gene3D: G3DSA:3.80.10.10
537-774 no description

PSSVRHLSIHLDSLSMLDETIPYMNLRTLIFFTSRMVAPINISIPQVVLDNLQSLRVLDLSPCKIDRLPDSIRQCVHLRYLNISSTAINMLPEYLGKLYHLQVLNLSGCRLEKLPSSINNLVSLRHLTAANQILSTITDIGSLRYLQRLPIFKVTSEETNSIIQLGYLQELRGSLHIRNLENIDAPDEAKEAMLCKKVNLTMLQLMWAPARDLVNSDKEAEVLEYLQPHPNLKRLDII

HMMPfam: PF13855
579-624 LRR_8,Leucine rich repeat

SIPQVVLDNLQSLRVLDLSPCKIDRLPDSIRQCVHLRYLNISSTAI

FPrintScan: PR00364
IPR000767
586-602 DISEASERSIST
Disease resistance protein

DNLQSLRVLDLSPCKID

HMMSmart: SM00369
IPR003591
588-611 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LQSLRVLDLSPCKIDRLPDSIRQC

ProfileScan: PS51450
IPR001611
590-611 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRVLDLSPCKIDRLPDSIRQC

ProfileScan: PS51450
IPR001611
613-634 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLRYLNISSTAINMLPEYLGKL

HMMSmart: SM00369
IPR003591
634-657 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LYHLQVLNLSGCRLEKLPSSINNL

ProfileScan: PS51450
IPR001611
636-657 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLQVLNLSGCRLEKLPSSINNL

HMMPfam: PF00560
IPR001611
636-657 LRR_1
Leucine-rich repeat

HLQVLNLSGCRLEKLPSSINNL

ProfileScan: PS51450
IPR001611
659-680 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRHLTAANQILSTITDIGSLR

Gene3D: G3DSA:3.80.10.10
784-896 no description

WLESKWLINLELIFLSGCNAWEQLPPLGQLPSVRTIWLQRLKTVRQIGLEVYGNRSSHVAFQSLEELVLDDMQELNEWSWTGQEMMNLRNIVIKDCQKLKELPPLPPSLTELT

ProfileScan: PS51450
IPR001611
792-814 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLELIFLSGCNAWEQLPPLGQLP

superfamily: SSF52047
844-1058 RNI-like,LRR

FQSLEELVLDDMQELNEWSWTGQEMMNLRNIVIKDCQKLKELPPLPPSLTELTIAKKGFWVPYHHDVKMTQLTTVTTVSSLCIFNCPKLLARFSSPVTNGVVASFQSLRSLIVDHMRILTCPLLRERLEHIENLDIQDCSEITTFTADNEDVFLHLRSLQSLCISGCNNLQSLPSSLSSLESLDKLILWNCPELELLPDEQLPLSLRKLEVALCN

Seg: seg
881-896 seg

KLKELPPLPPSLTELT

Seg: seg
915-924 seg

LTTVTTVSSL

Gene3D: G3DSA:3.80.10.10
919-1057 no description

TTVSSLCIFNCPKLLARFSSPVTNGVVASFQSLRSLIVDHMRILTCPLLRERLEHIENLDIQDCSEITTFTADNEDVFLHLRSLQSLCISGCNNLQSLPSSLSSLESLDKLILWNCPELELLPDEQLPLSLRKLEVALC

HMMSmart: SM00369
IPR003591
999-1023 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRSLQSLCISGCNNLQSLPSSLSSL

ProfileScan: PS51450
IPR001611
1001-1023 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQSLCISGCNNLQSLPSSLSSL

HMMPfam: PF00560
IPR001611
1001-1023 LRR_1
Leucine-rich repeat

SLQSLCISGCNNLQSLPSSLSSL

Seg: seg
1013-1031 seg

LQSLPSSLSSLESLDKLIL

Seg: seg
1035-1049 seg

PELELLPDEQLPLSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox