PRGDB00073198 (Os.86079)

From PRG Wiki
Jump to: navigation, search
Os.86079
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 112785428 (EE590664)
Gene Class Unknown
Domain Type
Gene Species Oryza sativa Japonica Group

Comment?

NEW_RNG08-A02-T7 Rice mixture of leaf, root, panicle Oryza sativa (japonica cultivar-group) cDNA, mRNA sequence

DNA Sequence

CATTCGGATGGAGGAGATAGAAGGTAATTTGCTGGAGTCCTCGATTGGATGGCTGGCGGATACCATAGTGGAGAACCTGGGCAACGACAAGTTTGGCGCGTGGATTAGCCAGGTCGGGCTCGCCGATGACACCGAAAAGCTCCGGTCTGAGGTCGAGAGGGTGGAGGTGGTGGTCGGTGCTGTCAAGGGGAGGGCGATCGCGAACAAACCGCTGGCCCGATCACTCGGTCGTCTAAGGGAGGTGCTGTACGACGCCGACGACGCGGTCGACGAGCTCGAATACTACAGGCTCCAGCATCAGCTCCAAGGAGATTCATGCGCGGATGAACATGGAGTAGAGCAAGCAGCGAGACCGAGTTGCAACGCTGGCATAGCAAGTAGCAGTGGTGGCAAAAAACGATCCAAGGCTTGGGAGGACTTCGATATCACGGAAAAGGAAAACGGAAAGGCGGTGAAGGCCAGATGTATCCACTGTCACACGGTGGTCAAGTGCGGTTCCGACAAAGGGACGTCAGTTTTACACAACCATCTGAAGAGTGACAATTGTAAGAAGAAACGTGAAGCAATTGGTCCGCCACCAGACCCTTCCAGGTATACTACCAAATCTGTGAATGATAGCTAAAAAGAGACACCATACTGCC


Protein sequences

Name Description Sequence
Os.86079 translated coding region predicted by ESTScan from UniGene Os.86079

XIRMEEIEGNLLESSIGWLADTIVENLGNDKFGAWISQVGLADDTEKLRSEVERVEVVVGAVKGRAIANKPLARSLGRLREVLYDADDAVDELEYYRLQHQLQGDSCADEHGVEQAARPSCNAGIASSSGGKKRSKAWEDFDITEKENGKAVKARCIHCHTVVKCGSDKGTSVLHNHLKSDNCKKKREAIGPPPDPSRYTTKSVNDS


Domains

Domain Start-End Description Sequence

Seg: seg
52-66 seg

VERVEVVVGAVKGRA

Seg: seg
123-137 seg

AGIASSSGGKKRSKA

ProfileScan: PS50808
IPR003656
132-190 ZF_BED
Zinc finger, BED-type predicted

KKRSKAWEDFDITEKENGKAVKARCIHCHTVVKCGSDKGTSVLHNHLKSDNCKKKREAI

HMMSmart: SM00614
IPR003656
132-186 BED zinc finger
Zinc finger, BED-type predicted

KKRSKAWEDFDITEKENGKAVKARCIHCHTVVKCGSDKGTSVLHNHLKSDNCKKK

superfamily: SSF57667
135-193 C2H2 and C2HC zinc fingers

SKAWEDFDITEKENGKAVKARCIHCHTVVKCGSDKGTSVLHNHLKSDNCKKKREAIGPP

HMMPfam: PF02892
IPR003656
135-183 zf-BED
Zinc finger, BED-type predicted

SKAWEDFDITEKENGKAVKARCIHCHTVVKCGSDKGTSVLHNHLKSDNC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox