PRGDB00073199 (Os.86145)

From PRG Wiki
Jump to: navigation, search
Os.86145
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 112785926 (EE591696)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

NEW_RNG28-F05 Rice mixture of leaf, root, panicle Oryza sativa (japonica cultivar-group) cDNA, mRNA sequence

DNA Sequence

CATTAGGAGATGGGGATCGTCAGCTCCGTCCGCCACGACAACACCATGCCGCTCGCCGGGTTCTGCCTCAACGACGACGGCGGCAGCGCCAAGCTCATGCTGGTCTACGACTACATGGCGAGAGGCAGCCTCGAGGAGATCTTGCACGGTGAAAAGGAGGGAAAAGATTTGTTTGGTTGGCCGGAGAGGTTCAAGGTGGCCGCCGGAGTAGCACGAGCGCTCGTGTACCTCCACGGCGGCGACGGCGATGGCCGGCCGGTGATCCATAGGGACGTCAAGTCGTCCAACATCCTCGTCTCTGAAGATTTCCAACCAAAGCTGTGTGACTTCGGCCTCGCGCTCTGGGCGGCGGAGGCGGCGTCTCCGGTCACCGGCGACGATGTCGCCGGCAAATTCGGGTACTTGGCTCCAGAGTACTTCATGCACGGCAAGGTCAGCGACAAGATCGATCGTGTACGCCTTCAGCGTCGTCCTCCTCGAGCTCGTCTCCGGGAGGAAGCCGGTGAGCTCCGGCGGCGGCAAGGGCAAGGAAAGCCTGGTCATGTGGGCGAACACCATCATACAAGGAGGAAAGCTCACTGACCTCGTCGACCCCAGCCTGCCGACGGACGGCGCGACGTCGCCGCGATGTCGAGAGGATGACCCTCCCCGCCGCCTCTGCATCGGCGATCGCCGCAACGGCGGCCTAGCATTGCAAATGTTCTCAAGCCGCTCGACGGCGATGGCGACGCTGTCAGGTGGGCGAGCTCGCAGGCCGGTCTGTCCGCAGGCGATGACACCGACGATGGCGATGGCGCTTCGCCGGAGAAGAAGGACATCCAGTCGTACATTAACCTTGCGCTGCTCGACGTCGACGACGACTCGGCGTCCGTCAGCAGCGGCGGCGCCGACTTCACGGCGGCGAACGTGTCGCTGGAGGAGTACATGAAGGGGAGATGGAGCCGGTCGTCGAGCTTCGACTGAAGAGATGA


Protein sequences

Name Description Sequence
Os.86145 translated coding region predicted by ESTScan from UniGene Os.86145

MGIVSSVRHDNTMPLAGFCLNDDGGSAKLMLVYDYMARGSLEEILHGEKEGKDLFGWPERFKVAAGVARALVYLHGGDGDGRPVIHRDVKSSNILVSEDFQPKLCDFGLALWAAEAASPVTGDDVAGKFGYLAPEYFMHGKVSDKIDRVRLQRRPPRARLREEAGELRRRQGQGKPGHVGEHHHTRRKAHXPRRPQPADGRRDVAAMSRGXPSPPPLHRRSPQRRPSIANVLKPLDGDGDAVRWASSQAGLSAGDDTDDGDGASPEKKDIQSYINLALLDVDDDSASVSSGGADFTAANVSLEEYMKGRWSRSSSFD

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-245 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

MGIVSSVRHDNTMPLAGFCLNDDGGSAKLMLVYDYMARGSLEEILHGEKEGKDLFGWPERFKVAAGVARALVYLHGGDGDGRPVIHRDVKSSNILVSEDFQPKLCDFGLALWAAEAASPVTGDDVAGKFGYLAPEYFMHGKVSDKIDRVRLQRRPPRARLREEAGELRRRQGQGKPGHVGEHHHTRRKAHXPRRPQPADGRRDVAAMSRGXPSPPPLHRRSPQRRPSIANVLKPLDGDGDAVRWA

HMMSmart: SM00220
IPR002290
1-235 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

MGIVSSVRHDNTMPLAGFCLNDDGGSAKLMLVYDYMARGSLEEILHGEKEGKDLFGWPERFKVAAGVARALVYLHGGDGDGRPVIHRDVKSSNILVSEDFQPKLCDFGLALWAAEAASPVTGDDVAGKFGYLAPEYFMHGKVSDKIDRVRLQRRPPRARLREEAGELRRRQGQGKPGHVGEHHHTRRKAHXPRRPQPADGRRDVAAMSRGXPSPPPLHRRSPQRRPSIANVLKPL

HMMSmart: SM00219
IPR020635
1-235 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

MGIVSSVRHDNTMPLAGFCLNDDGGSAKLMLVYDYMARGSLEEILHGEKEGKDLFGWPERFKVAAGVARALVYLHGGDGDGRPVIHRDVKSSNILVSEDFQPKLCDFGLALWAAEAASPVTGDDVAGKFGYLAPEYFMHGKVSDKIDRVRLQRRPPRARLREEAGELRRRQGQGKPGHVGEHHHTRRKAHXPRRPQPADGRRDVAAMSRGXPSPPPLHRRSPQRRPSIANVLKPL

HMMPfam: PF00069
IPR017442
3-147 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

IVSSVRHDNTMPLAGFCLNDDGGSAKLMLVYDYMARGSLEEILHGEKEGKDLFGWPERFKVAAGVARALVYLHGGDGDGRPVIHRDVKSSNILVSEDFQPKLCDFGLALWAAEAASPVTGDDVAGKFGYLAPEYFMHGKVSDKID

HMMPanther: PTHR24420:SF425
3-147 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

IVSSVRHDNTMPLAGFCLNDDGGSAKLMLVYDYMARGSLEEILHGEKEGKDLFGWPERFKVAAGVARALVYLHGGDGDGRPVIHRDVKSSNILVSEDFQPKLCDFGLALWAAEAASPVTGDDVAGKFGYLAPEYFMHGKVSDKID

HMMPanther: PTHR24420
3-147 FAMILY NOT NAMED,FAMILY NOT NAMED

IVSSVRHDNTMPLAGFCLNDDGGSAKLMLVYDYMARGSLEEILHGEKEGKDLFGWPERFKVAAGVARALVYLHGGDGDGRPVIHRDVKSSNILVSEDFQPKLCDFGLALWAAEAASPVTGDDVAGKFGYLAPEYFMHGKVSDKID

superfamily: SSF56112
IPR011009
3-147 Protein kinase-like (PK-like)
Protein kinase-like domain

IVSSVRHDNTMPLAGFCLNDDGGSAKLMLVYDYMARGSLEEILHGEKEGKDLFGWPERFKVAAGVARALVYLHGGDGDGRPVIHRDVKSSNILVSEDFQPKLCDFGLALWAAEAASPVTGDDVAGKFGYLAPEYFMHGKVSDKID

Gene3D: G3DSA:1.10.510.10
4-147 no description

VSSVRHDNTMPLAGFCLNDDGGSAKLMLVYDYMARGSLEEILHGEKEGKDLFGWPERFKVAAGVARALVYLHGGDGDGRPVIHRDVKSSNILVSEDFQPKLCDFGLALWAAEAASPVTGDDVAGKFGYLAPEYFMHGKVSDKID

PatternScan: PS00108
IPR008271
84-96 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDVKSSNILV

Seg: seg
150-174 seg

RLQRRPPRARLREEAGELRRRQGQG

Seg: seg
208-227 seg

SRGXPSPPPLHRRSPQRRPS

Seg: seg
254-262 seg

GDDTDDGDG

Seg: seg
276-294 seg

LALLDVDDDSASVSSGGAD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox