PRGDB00073518 (Pgl.214)

From PRG Wiki
Jump to: navigation, search
Pgl.214
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 211602362 (GE480938)
Gene Class T
Domain Type TIR, LRR
Gene Species Picea glauca

Comment?

GQ0201.B3.r_N04 GQ020: Clean ROOTS systems -Diurnal cycle Picea glauca cDNA clone GQ0201_N04 5', mRNA sequence

DNA Sequence

GTTCTTTGGACGAAAATATTGAGGTTGAGCACGCATTCCTAATTCTGCAGAGCGTATTGGATCTTGCTTCTTTATTATTCTGTATCCAATGGCACTCACTACATCCTTCGCATCCTCTTCCACATCCCACTCCCCTGGCCGTGTCTATGATGTGTTCATAAGTCACCGTGGTCCGGACGTAAAGAAAGGCATCGCTAGCCATATCTACCATCGCCTTAAAGATCTTGGATTAGCAGTCTTTCTGGATCAGCAAGAATTACAAGGAGGAGAGAACTTGAATCTTCAACTCGAAGGGGCTATTCAAACAGCCTCCGTCCATATTGCAATATTTTCTCGAGGATATGCCAACTCACGTTGGTGTCTCGATGAACTCTCACTCATGGTGGACTCAGGGTCAACCATCATTCCAGTTTTCTACGATGTCCAGCCCTCAGATCTCCGGTGGACGCGGGGCGGAGATAGAGTGTACGCTCGAGCCCTGAGCATCTTCCTGTGTATCCTCTTGAGCATCCTCCTGTGTATCCCCACGAGCTTCCTTTTGAGATTCCTCCTGTGTGTTCCCTTCAGTATCATGATGTGCATCCTCTTCTGTACGCGGGGCAAAAATGGAGTGTACGCTCGAGCCCTGCACGAGCTCCAAAATAAGACAACAGTGGATTCTGCAACCAAGAAAAAGAAGCCACGACATGACTCCGGCACTATTGAGAAATGGAGGACGGCCCTTTCTGATGTTTCAAAAATATCCGGTTTTGAACTAAAGGAGTGTAACGGTGACGAGGGGCAGCTCGTCAATAAGGTCGTCAAACAAGTTTTTATAAAAGTTCGAAAACCATCTCTATCTCTATATGTAGCTAAATATCCAACTGGCCTGCTTGAAAAAGTAAAAGAGTTGAAAATGACAGTGTCATTGCAGC


Protein sequences

Name Description Sequence
Pgl.214 translated coding region predicted by ESTScan from UniGene Pgl.214

MALTTSFASSSTSHSPGRVYDVFISHRGPDVKKGIASHIYHRLKDLGLAVFLDQQELQGGENLNLQLEGAIQTASVHIAIFSRGYANSRWCLDELSLMVDSGSTIIPVFYDVQPSDLRWTRGGDRVYARALSIFLCILLSILLCIPTSFLLRFLLCVPFSIMMCILFCTRGKNGVYARALHELQNKTTVDSATKKKKPRHDSGTIEKWRTALSDVSKISGFELKECNGDEGQLVNKVVKQVFIKVRKPSLSLYVAKYPTGLLEKVKELKMTVSLQX

Domains

Domain Start-End Description Sequence

Seg: seg
4-15 seg

TTSFASSSTSHS

superfamily: SSF52200
IPR000157
8-131 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

ASSSTSHSPGRVYDVFISHRGPDVKKGIASHIYHRLKDLGLAVFLDQQELQGGENLNLQLEGAIQTASVHIAIFSRGYANSRWCLDELSLMVDSGSTIIPVFYDVQPSDLRWTRGGDRVYARAL

ProfileScan: PS50104
IPR000157
18-121 TIR
Toll-Interleukin receptor

RVYDVFISHRGPDVKKGIASHIYHRLKDLGLAVFLDQQELQGGENLNLQLEGAIQTASVHIAIFSRGYANSRWCLDELSLMVDSGSTIIPVFYDVQPSDLRWTR

Gene3D: G3DSA:3.40.50.10140
19-118 no description

VYDVFISHRGPDVKKGIASHIYHRLKDLGLAVFLDQQELQGGENLNLQLEGAIQTASVHIAIFSRGYANSRWCLDELSLMVDSGSTIIPVFYDVQPSDLR

HMMSmart: SM00255
IPR000157
19-218 Toll
Toll/interleukin-1 receptor homology (TIR) domain

VYDVFISHRGPDVKKGIASHIYHRLKDLGLAVFLDQQELQGGENLNLQLEGAIQTASVHIAIFSRGYANSRWCLDELSLMVDSGSTIIPVFYDVQPSDLRWTRGGDRVYARALSIFLCILLSILLCIPTSFLLRFLLCVPFSIMMCILFCTRGKNGVYARALHELQNKTTVDSATKKKKPRHDSGTIEKWRTALSDVSKI

HMMPfam: PF13676
22-112 TIR_2,TIR domain

VFISHRGPDVKKGIASHIYHRLKDLGLAVFLDQQELQGGENLNLQLEGAIQTASVHIAIFSRGYANSRWCLDELSLMVDSGSTIIPVFYDV

Seg: seg
131-145 seg

LSIFLCILLSILLCI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox