PRGDB00073521 (Pgl.396)

From PRG Wiki
Jump to: navigation, search
Pgl.396
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157640872 (EX441954)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Picea glauca

Comment?

GQ04104.B7_F03 GQ041 - Shoot tip - Dormant (Normalized) Picea glauca cDNA clone GQ04104_F03 5', mRNA sequence

DNA Sequence

TTCGAGGGATTGCTTGAAGATGGTACCAAAGTGGCTGTAAAACGTGGAAATCGAAGCTCTGAACAAGGCATAGCAGAATTACGGACTGAAATTGAAATGTTGTCTAAGCTTCGCCACCGTCATCTGGTTTCTCTTATTGGCTATTGTGAGGAGCACTGTGAAATGATTTTGGTTTATGAATACATGGCCAATGGACCTCTTAGGAGCCATTTGTATGGATCAGATCTTCCTCCTATGTCATGGAAGCAGAGGCTTGATATATGCATAGGGTCTGCTAGGGGTCTTCATTACCTTCACACAGGAGCAGAGCAGGGAATCATTCACCGTGATGTAAAGACAACGAACATTTTGTTGGATGAGAATTTTGTGGCCAAGGTGGCAGACTTCGGGCTTTCAAAGAATGGACCTGCTCTGGATCAAACCCATGTGAGTACTGCAGTCAAAGGTAGCTTTGGATATCTTGACCCTGAGTACTTTAGAAGGCAGCAATTGACTGAAAAATCCGATGTCTATTCCTTTGGAGTAGTGCTAGTGGAGGTACTATGTGCAAGGCCAGCCATCAATCCTTCTCTTCCCAGAGATAAAGTCAATATAGCAGAGTGGACCATGCATTGGCATAGTAAAGGCATGCTTGGCCAAATTATTGATCACCATCTTGTAATAGCATCAACCCTAACTCCCTGAGAAAGTTTGGAGAGACGGCTGCAAAGTGTTTAGCTGGCCAGGGTATTGACAGGCCCACCATGGGTGATGTGCTGTGGAACTTAGAATATGCCCTTCAACTCCAGGAAACTTCGATGCTGGATGATCCAGATGAAAACAGTGCTAATCGCATTTCAGAGATTCCCTTATGCTTTTCTCAGCCAGAGCATTTTGGTAATAGCACTAT


Protein sequences

Name Description Sequence
Pgl.396 translated coding region predicted by ESTScan from UniGene Pgl.396

FEGLLEDGTKVAVKRGNRSSEQGIAELRTEIEMLSKLRHRHLVSLIGYCEEHCEMILVYEYMANGPLRSHLYGSDLPPMSWKQRLDICIGSARGLHYLHTGAEQGIIHRDVKTTNILLDENFVAKVADFGLSKNGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLVEVLCARPAINPSLPRDKVNIAEWTMHWHSKGMLGQIIDHHLXNSINPNSLRKFGETAAKCLAGQGIDRPTMGDVLWNLEYALQLQETSMLDDPDENSANRISEIPLCFSQPEHFGNSTX

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
1-264 Protein kinase-like (PK-like)
Protein kinase-like domain

FEGLLEDGTKVAVKRGNRSSEQGIAELRTEIEMLSKLRHRHLVSLIGYCEEHCEMILVYEYMANGPLRSHLYGSDLPPMSWKQRLDICIGSARGLHYLHTGAEQGIIHRDVKTTNILLDENFVAKVADFGLSKNGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLVEVLCARPAINPSLPRDKVNIAEWTMHWHSKGMLGQIIDHHLXNSINPNSLRKFGETAAKCLAGQGIDRPTMGDVLWNLEYALQLQE

HMMPanther: PTHR24420:SF550
1-283 SUBFAMILY NOT NAMED

FEGLLEDGTKVAVKRGNRSSEQGIAELRTEIEMLSKLRHRHLVSLIGYCEEHCEMILVYEYMANGPLRSHLYGSDLPPMSWKQRLDICIGSARGLHYLHTGAEQGIIHRDVKTTNILLDENFVAKVADFGLSKNGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLVEVLCARPAINPSLPRDKVNIAEWTMHWHSKGMLGQIIDHHLXNSINPNSLRKFGETAAKCLAGQGIDRPTMGDVLWNLEYALQLQETSMLDDPDENSANRISEIP

HMMPanther: PTHR24420
1-283 FAMILY NOT NAMED,FAMILY NOT NAMED

FEGLLEDGTKVAVKRGNRSSEQGIAELRTEIEMLSKLRHRHLVSLIGYCEEHCEMILVYEYMANGPLRSHLYGSDLPPMSWKQRLDICIGSARGLHYLHTGAEQGIIHRDVKTTNILLDENFVAKVADFGLSKNGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLVEVLCARPAINPSLPRDKVNIAEWTMHWHSKGMLGQIIDHHLXNSINPNSLRKFGETAAKCLAGQGIDRPTMGDVLWNLEYALQLQETSMLDDPDENSANRISEIP

ProfileScan: PS50011
IPR000719
1-259 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FEGLLEDGTKVAVKRGNRSSEQGIAELRTEIEMLSKLRHRHLVSLIGYCEEHCEMILVYEYMANGPLRSHLYGSDLPPMSWKQRLDICIGSARGLHYLHTGAEQGIIHRDVKTTNILLDENFVAKVADFGLSKNGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLVEVLCARPAINPSLPRDKVNIAEWTMHWHSKGMLGQIIDHHLXNSINPNSLRKFGETAAKCLAGQGIDRPTMGDVLWNLEYA

HMMSmart: SM00220
IPR002290
1-259 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FEGLLEDGTKVAVKRGNRSSEQGIAELRTEIEMLSKLRHRHLVSLIGYCEEHCEMILVYEYMANGPLRSHLYGSDLPPMSWKQRLDICIGSARGLHYLHTGAEQGIIHRDVKTTNILLDENFVAKVADFGLSKNGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLVEVLCARPAINPSLPRDKVNIAEWTMHWHSKGMLGQIIDHHLXNSINPNSLRKFGETAAKCLAGQGIDRPTMGDVLWNLEYA

HMMSmart: SM00219
IPR020635
1-256 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FEGLLEDGTKVAVKRGNRSSEQGIAELRTEIEMLSKLRHRHLVSLIGYCEEHCEMILVYEYMANGPLRSHLYGSDLPPMSWKQRLDICIGSARGLHYLHTGAEQGIIHRDVKTTNILLDENFVAKVADFGLSKNGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLVEVLCARPAINPSLPRDKVNIAEWTMHWHSKGMLGQIIDHHLXNSINPNSLRKFGETAAKCLAGQGIDRPTMGDVLWNL

Gene3D: G3DSA:3.30.200.20
2-47 no description

EGLLEDGTKVAVKRGNRSSEQGIAELRTEIEMLSKLRHRHLVSLIG

HMMPfam: PF07714
IPR001245
7-252 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

DGTKVAVKRGNRSSEQGIAELRTEIEMLSKLRHRHLVSLIGYCEEHCEMILVYEYMANGPLRSHLYGSDLPPMSWKQRLDICIGSARGLHYLHTGAEQGIIHRDVKTTNILLDENFVAKVADFGLSKNGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLVEVLCARPAINPSLPRDKVNIAEWTMHWHSKGMLGQIIDHHLXNSINPNSLRKFGETAAKCLAGQGIDRPTMGDV

Gene3D: G3DSA:1.10.510.10
48-254 no description

YCEEHCEMILVYEYMANGPLRSHLYGSDLPPMSWKQRLDICIGSARGLHYLHTGAEQGIIHRDVKTTNILLDENFVAKVADFGLSKNGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLVEVLCARPAINPSLPRDKVNIAEWTMHWHSKGMLGQIIDHHLXNSINPNSLRKFGETAAKCLAGQGIDRPTMGDVLW

PatternScan: PS00108
IPR008271
106-118 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKTTNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox