PRGDB00073523 (Pgl.527)

From PRG Wiki
Jump to: navigation, search
Pgl.527
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157525692 (EX326923)
Gene Class Unknown
Domain Type
Gene Species Picea glauca

Comment?

GQ02826.B7_B20 GQ028 - Cambium

DNA Sequence

ATAGTGATTTCCTATTTGTTTGCTTGAGTTTGTCCAGTCCGCCCGCATTATACGTTGTTAGCCCTTCAGGAGTCACCGTGAATCCTAAAAATGACCTCTGCAACTTTCACAGGTAGAACCATTCTTTGTGTGACAGGAGCAACAGGTTTCGTGGCCTCCTCGCTGGTCAAGCACCTACTCCACCAGGGTTACACTGTTCACGCCACTGTGCGCGATCCAGAGAACGAGGGGAAGGTGCGGCATCTGCTCGACATTCCAGGCGCTGGAGAGAGGCTCAAAGTCTTCAGAGCGGATCTACTGGAAGAAGGAAGCTTCGATGCTGCCATCGACCGTTGTGATGGCGTTTTCCATGTGGCCAGTCCCGTCAACTTCACCCCCAAAAATCCCGAGAGCGATGTCTTGAACCCGGCAGTCGACGGGACGCTGAATGTTCTGAGGGCCTGCACGAAGGCTAAAACCGTAAAGCGCGTTGTGGTCACATCGTCTGCGTCCACGGCTTCGATAAACGAGTCAGAGGAGCAGAGTCAATGTATCGACGAAACCTGCTGGACAGACGTGGATTTCCTCCAGACTAACAAGCCGCCTGCCTGGGCATATCCAGTTTCGAAGACGCTCGCGGAGCAAGCAGCACTGCAGTACGGGGATGAGCAGGGGTTGGATGTGGTCACGATCAACCCTGTCCTGGTGGCCGGGTGTTCCATTAACCCGAACGTCCCACAGACCATCGAGGTTGTCCTTTCCCTCCTCACTGGCATTTCCAAAGACCTAGAAGCTTTTAATATTATTCAGATGGTGTACGGATTCGCTTCGTTGGTTCACGTGGACGACGTCTGCAGCGCCCAGATTTTCTTGATGGACAAACCCTCTGCAGTGGGCCGTTACATCCTGCTGTTCCGTTAACAGCTCTATTTCACAGCTCGCACAATACTTATGCA


Protein sequences

Name Description Sequence
Pgl.527 translated coding region predicted by ESTScan from UniGene Pgl.527

MTSATFTGRTILCVTGATGFVASSLVKHLLHQGYTVHATVRDPENEGKVRHLLDIPGAGERLKVFRADLLEEGSFDAAIDRCDGVFHVASPVNFTPKNPESDVLNPAVDGTLNVLRACTKAKTVKRVVVTSSASTASINESEEQSQCIDETCWTDVDFLQTNKPPAWAYPVSKTLAEQAALQYGDEQGLDVVTINPVLVAGCSINPNVPQTIEVVLSLLTGISKDLEAFNIIQMVYGFASLVHVDDVCSAQIFLMDKPSAVGRYILLFRXQLYFTARTILMX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366:SF9
1-265 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

MTSATFTGRTILCVTGATGFVASSLVKHLLHQGYTVHATVRDPENEGKVRHLLDIPGAGERLKVFRADLLEEGSFDAAIDRCDGVFHVASPVNFTPKNPESDVLNPAVDGTLNVLRACTKAKTVKRVVVTSSASTASINESEEQSQCIDETCWTDVDFLQTNKPPAWAYPVSKTLAEQAALQYGDEQGLDVVTINPVLVAGCSINPNVPQTIEVVLSLLTGISKDLEAFNIIQMVYGFASLVHVDDVCSAQIFLMDKPSAVGRYI

HMMPanther: PTHR10366
1-265 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

MTSATFTGRTILCVTGATGFVASSLVKHLLHQGYTVHATVRDPENEGKVRHLLDIPGAGERLKVFRADLLEEGSFDAAIDRCDGVFHVASPVNFTPKNPESDVLNPAVDGTLNVLRACTKAKTVKRVVVTSSASTASINESEEQSQCIDETCWTDVDFLQTNKPPAWAYPVSKTLAEQAALQYGDEQGLDVVTINPVLVAGCSINPNVPQTIEVVLSLLTGISKDLEAFNIIQMVYGFASLVHVDDVCSAQIFLMDKPSAVGRYI

superfamily: SSF51735
10-266 NAD(P)-binding Rossmann-fold domains

TILCVTGATGFVASSLVKHLLHQGYTVHATVRDPENEGKVRHLLDIPGAGERLKVFRADLLEEGSFDAAIDRCDGVFHVASPVNFTPKNPESDVLNPAVDGTLNVLRACTKAKTVKRVVVTSSASTASINESEEQSQCIDETCWTDVDFLQTNKPPAWAYPVSKTLAEQAALQYGDEQGLDVVTINPVLVAGCSINPNVPQTIEVVLSLLTGISKDLEAFNIIQMVYGFASLVHVDDVCSAQIFLMDKPSAVGRYIL

Gene3D: G3DSA:3.40.50.720
IPR016040
12-246 no description
NAD(P)-binding domain

LCVTGATGFVASSLVKHLLHQGYTVHATVRDPENEGKVRHLLDIPGAGERLKVFRADLLEEGSFDAAIDRCDGVFHVASPVNFTPKNPESDVLNPAVDGTLNVLRACTKAKTVKRVVVTSSASTASINESEEQSQCIDETCWTDVDFLQTNKPPAWAYPVSKTLAEQAALQYGDEQGLDVVTINPVLVAGCSINPNVPQTIEVVLSLLTGISKDLEAFNIIQMVYGFASLVHVDD

HMMPfam: PF01370
IPR001509
13-260 Epimerase
NAD-dependent epimerase/dehydratase

CVTGATGFVASSLVKHLLHQGYTVHATVRDPENEGKVRHLLDIPGAGERLKVFRADLLEEGSFDAAIDRCDGVFHVASPVNFTPKNPESDVLNPAVDGTLNVLRACTKAKTVKRVVVTSSASTASINESEEQSQCIDETCWTDVDFLQTNKPPAWAYPVSKTLAEQAALQYGDEQGLDVVTINPVLVAGCSINPNVPQTIEVVLSLLTGISKDLEAFNIIQMVYGFASLVHVDDVCSAQIFLMDKPSA

Seg: seg
117-137 seg

ACTKAKTVKRVVVTSSASTAS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox