PRGDB00073527 (Pgl.738)

From PRG Wiki
Jump to: navigation, search
Pgl.738
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157600707 (EX401931)
Gene Class N
Domain Type NBS
Gene Species Picea glauca

Comment?

GQ03503.B7_J16 GQ035 - Needles - End of season Picea glauca cDNA clone GQ03503_J16 5', mRNA sequence

DNA Sequence

AGAATTACTCGGCTTTTCATAAAAAATGGAAGAAATACAGTCATCCCCAGACTCACACGGGCCTTCGCTTAACAAATCTAAGTCCCGAAGAAATTTAAGTGGTAACTCAATTTCTTCTCAAAATAGCAACGGTGATTTGGAGAATGGTATTAGTGGTGATGATCAGATGAGAAAGAACAACAATGGTTTTAATGGGAAGGCAGCACGGAGGGAAGGGGTTCTTGTTTGGAGAGACTTGACAATTACAATGAGAGGAAAGAGGACATACTCTGATAAGGTCATAAAGTCATGCACAGGATACGCACTTCCCGGGACTCTCACAGTCATCATGGGTCCTGCTAAATCTGGGAAGACAACGTTGTTGAGAGCGCTTGCAGGATTATTGCCCGACACAGCGAAGGTCTATGGGGAGGTGCTTGTCAATGGGCAAAAGTCGCAGCTCAAATATGGCACTTATGCATATATTGGGAGAGGAGATGAACTGATTGAGACTCTTACAGTACGTGAAATGCTGTACTATTCATCACTTTTACAACTTCCAGGCTTCATCTCACGCAAGAAAAAGGCTGCTTTGGTGGACAATGCCATCTTAGCTATGTCCTTGGAAGACTATGCAGATAGACGTATAGGAGGTAACTGCTACAGGAAGGGCTTAACAAGTGGGGAAAGAAGACGTGTTAGCATTTGCAGGGAGCTGATTGGAAGTCCACAATTCGTTTTTATTGATGAACCACTTTATCACCTTGACTGTGTATCTGCACTTTTGATGATGGTGACACTGAAGAGACTTGCAAGCACAGGGTGTACAGTCATATTTACTATGTATCATAGCAGCACTGAAGTATTTGGGCTCTTTGAAGGATCTGCTTGCTAGCAAATGGGAAAATGCTATTCTTTGGGGATACTTTAGCCTGCTTGAAACACTT


Protein sequences

Name Description Sequence
Pgl.738 translated coding region predicted by ESTScan from UniGene Pgl.738

MEEIQSSPDSHGPSLNKSKSRRNLSGNSISSQNSNGDLENGISGDDQMRKNNNGFNGKAARREGVLVWRDLTITMRGKRTYSDKVIKSCTGYALPGTLTVIMGPAKSGKTTLLRALAGLLPDTAKVYGEVLVNGQKSQLKYGTYAYIGRGDELIETLTVREMLYYSSLLQLPGFISRKKKAALVDNAILAMSLEDYADRRIGGNCYRKGLTSGERRRVSICRELIGSPQFVFIDEPLYHLDCVSALLMMVTLKRLASTGCTVIFTMIIAALKYLGSLKDLLASKWENAILWGYFSLLETL

Domains

Domain Start-End Description Sequence

Seg: seg
23-35 seg

NLSGNSISSQNSN

superfamily: SSF52540
45-265 P-loop containing nucleoside triphosphate hydrolases

DDQMRKNNNGFNGKAARREGVLVWRDLTITMRGKRTYSDKVIKSCTGYALPGTLTVIMGPAKSGKTTLLRALAGLLPDTAKVYGEVLVNGQKSQLKYGTYAYIGRGDELIETLTVREMLYYSSLLQLPGFISRKKKAALVDNAILAMSLEDYADRRIGGNCYRKGLTSGERRRVSICRELIGSPQFVFIDEPLYHLDCVSALLMMVTLKRLASTGCTVIFT

Gene3D: G3DSA:3.40.50.300
63-265 no description

EGVLVWRDLTITMRGKRTYSDKVIKSCTGYALPGTLTVIMGPAKSGKTTLLRALAGLLPDTAKVYGEVLVNGQKSQLKYGTYAYIGRGDELIETLTVREMLYYSSLLQLPGFISRKKKAALVDNAILAMSLEDYADRRIGGNCYRKGLTSGERRRVSICRELIGSPQFVFIDEPLYHLDCVSALLMMVTLKRLASTGCTVIFT

HMMPanther: PTHR19241:SF20
65-266 ATP-BINDING CASSETTE TRANSPORTER PLANT,ATP-BINDING CASSETTE TRANSPORTER PLANT

VLVWRDLTITMRGKRTYSDKVIKSCTGYALPGTLTVIMGPAKSGKTTLLRALAGLLPDTAKVYGEVLVNGQKSQLKYGTYAYIGRGDELIETLTVREMLYYSSLLQLPGFISRKKKAALVDNAILAMSLEDYADRRIGGNCYRKGLTSGERRRVSICRELIGSPQFVFIDEPLYHLDCVSALLMMVTLKRLASTGCTVIFTM

HMMPanther: PTHR19241
65-266 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

VLVWRDLTITMRGKRTYSDKVIKSCTGYALPGTLTVIMGPAKSGKTTLLRALAGLLPDTAKVYGEVLVNGQKSQLKYGTYAYIGRGDELIETLTVREMLYYSSLLQLPGFISRKKKAALVDNAILAMSLEDYADRRIGGNCYRKGLTSGERRRVSICRELIGSPQFVFIDEPLYHLDCVSALLMMVTLKRLASTGCTVIFTM

ProfileScan: PS50893
IPR003439
66-299 ABC_TRANSPORTER_2
ABC transporter-like

LVWRDLTITMRGKRTYSDKVIKSCTGYALPGTLTVIMGPAKSGKTTLLRALAGLLPDTAKVYGEVLVNGQKSQLKYGTYAYIGRGDELIETLTVREMLYYSSLLQLPGFISRKKKAALVDNAILAMSLEDYADRRIGGNCYRKGLTSGERRRVSICRELIGSPQFVFIDEPLYHLDCVSALLMMVTLKRLASTGCTVIFTMIIAALKYLGSLKDLLASKWENAILWGYFSLLET

HMMSmart: SM00382
IPR003593
95-274 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGTLTVIMGPAKSGKTTLLRALAGLLPDTAKVYGEVLVNGQKSQLKYGTYAYIGRGDELIETLTVREMLYYSSLLQLPGFISRKKKAALVDNAILAMSLEDYADRRIGGNCYRKGLTSGERRRVSICRELIGSPQFVFIDEPLYHLDCVSALLMMVTLKRLASTGCTVIFTMIIAALKYL

HMMPfam: PF00005
IPR003439
110-237 ABC_tran
ABC transporter-like

TTLLRALAGLLPDTAKVYGEVLVNGQKSQLKYGTYAYIGRGDELIETLTVREMLYYSSLLQLPGFISRKKKAALVDNAILAMSLEDYADRRIGGNCYRKGLTSGERRRVSICRELIGSPQFVFIDEPL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox