PRGDB00073528 (Pgl.908)

From PRG Wiki
Jump to: navigation, search
Pgl.908
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 211893510 (DV987287)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Picea glauca

Comment?

GQ0206.TB_K11 GQ020: Clean ROOTS systems -Diurnal cycle Picea glauca cDNA clone GQ0206_K11 3', mRNA sequence

DNA Sequence

TGCATTCCAAATGATTTAAAAATAGAGTTCCAGAGACCAAGAGAGTGTTCATTCATTGCAAGTCAATGAATGCTCTCAAGTGCAATATTCAAAATACAAAAAGAAATTCAAAATTCTACAGGTGCAAAGACTGCAGGAGAGGAGACAGGTCACAAGATCGCTGTTCATACTTCTTCAAAAAGGGATGCAAAAGCAGTCCATGTGCAGTATGGCGAAGTAATGCATCCTTTTGTAGGCAACATCTGATAAAACTCTGAAACTCTGGAGATGCATCAGGTGGCGGGGATGGAGGGTCGCCCAAACAGATGGCCACCATTAAAGTAGGCCAATCAGGCCTCTGCCCCGGGGACAGACATGGGAACCTTCCAAGCGCACACTCCAGTAAAGATAATCCCAAACTCCATATATCTGCAGAGCACCCATCATACTTTCCACCATACCCATCAGGATCGAACCTCTCAGGACTCATATAAGCACAAGTGCCCACGAAGGAATTACACTGAGCCAAAGTGTGAGCCAACACAGTGCTGACACCGAAATCGGCAATCTTGACTTCTCTTCTCTTGTTGATCAGCAAATTGGAGGGTTTTATATCACGATGAACAATTTTGTTCTGGTGCAAGTAAAACAAGCCCTTCAGCACCTGCCTGGCAACCTCAGCCAAATAGTGTTCTGGGATTTTCTTGTGGGCTTGAAGAACCTGCGCAAGGGTTCCACCGTCCATGTACTCCAACACAAAAGAGATCTCTCCTCCTCGATCGAATATGCCATAACACTGCACGATGTGTGGAGAATTCGCCCTTCGGAGAATCTCCATTTCCCTCATTATTTGCTTTCGGACAGCAAGCTCGTGCTTTTCCTGAATGATTTTGAGGGCATAAATTTTTCCAGTCTTCACATGCTTTAACTTGTAGACCTTACCACTGCTCCCACACCCCAAAGTTGAAATCTTCTGG


Protein sequences

Name Description Sequence
Pgl.908 translated coding region predicted by ESTScan from UniGene Pgl.908

XQKISTLGCGSSGKVYKLKHVKTGKIYALKIIQEKHELAVRKQIMREMEILRRANSPHIVQCYGIFDRGGEISFVLEYMDGGTLAQVLQAHKKIPEHYLAEVARQVLKGLFYLHQNKIVHRDIKPSNLLINKRREVKIADFGVSTVLAHTLAQCNSFVGTCAYMSPERFDPDGYGGKYDGCSADIWSLGLSLLECALGRFPCLSPGQRPDWPTLMVAICLGDPPSPPPDASPEFQSFIRCCLQKDALLRHTAHGLLLHPFLKKYEQRSCDLSPLLQSLHL

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-261 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XQKISTLGCGSSGKVYKLKHVKTGKIYALKIIQEKHELAVRKQIMREMEILRRANSPHIVQCYGIFDRGGEISFVLEYMDGGTLAQVLQAHKKIPEHYLAEVARQVLKGLFYLHQNKIVHRDIKPSNLLINKRREVKIADFGVSTVLAHTLAQCNSFVGTCAYMSPERFDPDGYGGKYDGCSADIWSLGLSLLECALGRFPCLSPGQRPDWPTLMVAICLGDPPSPPPDASPEFQSFIRCCLQKDALLRHTAHGLLLHPFL

HMMSmart: SM00219
IPR020635
1-261 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

XQKISTLGCGSSGKVYKLKHVKTGKIYALKIIQEKHELAVRKQIMREMEILRRANSPHIVQCYGIFDRGGEISFVLEYMDGGTLAQVLQAHKKIPEHYLAEVARQVLKGLFYLHQNKIVHRDIKPSNLLINKRREVKIADFGVSTVLAHTLAQCNSFVGTCAYMSPERFDPDGYGGKYDGCSADIWSLGLSLLECALGRFPCLSPGQRPDWPTLMVAICLGDPPSPPPDASPEFQSFIRCCLQKDALLRHTAHGLLLHPFL

HMMSmart: SM00220
IPR002290
1-261 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

XQKISTLGCGSSGKVYKLKHVKTGKIYALKIIQEKHELAVRKQIMREMEILRRANSPHIVQCYGIFDRGGEISFVLEYMDGGTLAQVLQAHKKIPEHYLAEVARQVLKGLFYLHQNKIVHRDIKPSNLLINKRREVKIADFGVSTVLAHTLAQCNSFVGTCAYMSPERFDPDGYGGKYDGCSADIWSLGLSLLECALGRFPCLSPGQRPDWPTLMVAICLGDPPSPPPDASPEFQSFIRCCLQKDALLRHTAHGLLLHPFL

HMMPfam: PF00069
IPR017442
2-261 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

QKISTLGCGSSGKVYKLKHVKTGKIYALKIIQEKHELAVRKQIMREMEILRRANSPHIVQCYGIFDRGGEISFVLEYMDGGTLAQVLQAHKKIPEHYLAEVARQVLKGLFYLHQNKIVHRDIKPSNLLINKRREVKIADFGVSTVLAHTLAQCNSFVGTCAYMSPERFDPDGYGGKYDGCSADIWSLGLSLLECALGRFPCLSPGQRPDWPTLMVAICLGDPPSPPPDASPEFQSFIRCCLQKDALLRHTAHGLLLHPFL

superfamily: SSF56112
IPR011009
2-264 Protein kinase-like (PK-like)
Protein kinase-like domain

QKISTLGCGSSGKVYKLKHVKTGKIYALKIIQEKHELAVRKQIMREMEILRRANSPHIVQCYGIFDRGGEISFVLEYMDGGTLAQVLQAHKKIPEHYLAEVARQVLKGLFYLHQNKIVHRDIKPSNLLINKRREVKIADFGVSTVLAHTLAQCNSFVGTCAYMSPERFDPDGYGGKYDGCSADIWSLGLSLLECALGRFPCLSPGQRPDWPTLMVAICLGDPPSPPPDASPEFQSFIRCCLQKDALLRHTAHGLLLHPFLKKY

HMMPanther: PTHR24361:SF31
2-263 SUBFAMILY NOT NAMED

QKISTLGCGSSGKVYKLKHVKTGKIYALKIIQEKHELAVRKQIMREMEILRRANSPHIVQCYGIFDRGGEISFVLEYMDGGTLAQVLQAHKKIPEHYLAEVARQVLKGLFYLHQNKIVHRDIKPSNLLINKRREVKIADFGVSTVLAHTLAQCNSFVGTCAYMSPERFDPDGYGGKYDGCSADIWSLGLSLLECALGRFPCLSPGQRPDWPTLMVAICLGDPPSPPPDASPEFQSFIRCCLQKDALLRHTAHGLLLHPFLKK

HMMPanther: PTHR24361
2-263 FAMILY NOT NAMED,MITOGEN-ACTIVATED KINASE KINASE KINASE

QKISTLGCGSSGKVYKLKHVKTGKIYALKIIQEKHELAVRKQIMREMEILRRANSPHIVQCYGIFDRGGEISFVLEYMDGGTLAQVLQAHKKIPEHYLAEVARQVLKGLFYLHQNKIVHRDIKPSNLLINKRREVKIADFGVSTVLAHTLAQCNSFVGTCAYMSPERFDPDGYGGKYDGCSADIWSLGLSLLECALGRFPCLSPGQRPDWPTLMVAICLGDPPSPPPDASPEFQSFIRCCLQKDALLRHTAHGLLLHPFLKK

Gene3D: G3DSA:3.30.200.20
3-95 no description

KISTLGCGSSGKVYKLKHVKTGKIYALKIIQEKHELAVRKQIMREMEILRRANSPHIVQCYGIFDRGGEISFVLEYMDGGTLAQVLQAHKKIP

PatternScan: PS00107
IPR017441
7-30 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGCGSSGKVYKLKHVKTGKIYALK

Gene3D: G3DSA:1.10.510.10
96-267 no description

EHYLAEVARQVLKGLFYLHQNKIVHRDIKPSNLLINKRREVKIADFGVSTVLAHTLAQCNSFVGTCAYMSPERFDPDGYGGKYDGCSADIWSLGLSLLECALGRFPCLSPGQRPDWPTLMVAICLGDPPSPPPDASPEFQSFIRCCLQKDALLRHTAHGLLLHPFLKKYEQR

PatternScan: PS00108
IPR008271
118-130 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDIKPSNLLI

Seg: seg
222-232 seg

DPPSPPPDASP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox