PRGDB00073530 (Pgl.942)

From PRG Wiki
Jump to: navigation, search
Pgl.942
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 83400737 (DV994714)
Gene Class Unknown
Domain Type
Gene Species Picea glauca

Comment?

GQ027126.B3_B09 GQ027: Mature Somatic EMBRYOS Picea glauca cDNA clone GenomeQuebec_Id:GQ027126_B09 5', mRNA sequence

DNA Sequence

CTCGCTGAAAAAATGAGCGAGGTATGCGTGACAGGAGGCACAGGCTTCATAGCTGCTTATCTCGTTCTTAATCTTCTCCAGAAAGGCTACAGAGTTCGCACTACCGTTCGCAATCCAGATAATGTGGAGAAGTTTAGTTATCTGTGGGATCTGCCGGGTGCAAAGGAGAGACTGAAGATCGTGAGAGCAGATTTGCTAGAAGAGGGCAGTTTTGATGCAGCGGTGGAGGGTGTAGATGGAGTATTCCATACTGCATCACCTGTCTTAGTCCCATATAACGAGCGTTTGAAGGAAACCCTAATAGATCCTTGTGTGAAGGGCACTCTCAATGTCCTCAGGTCCTGTTCAAGATCACCTTCTGTTAAGCGGGTGGTGATTACATCCTCCTGCTCATCAATACGATACGACTATAATAGCCCAGAGCGTTCCCCGCTCGATGAGTCACACTGGAGCAATCTAGATTATTGCAAGAAGTACAATCTCTGGTATGCATATGCAAAAACTATTGCTGAGAAAGAGGCCTGGAAGTTCGCGGAGGAGCAGGGTCTCAATCTAGTCGTGGTGAACCCATCATTCGTTATTGGGCCACTTCTAGCCCCTGAACCTACCAGCACTCTTTTCGTAGTGCTGAGCATAATTAAGGGAGAAAATAACAAGGTATACCCAAATTCCAGGATGGGTTTTGTTCATATAGATGATGTAGTAGAAGCTCATATTCTGGCCATGGAGGCTCCGTCAGCATCGGGGAGAATCATCTGCTCTGCTGATGTTGCTCATTGGAAAGAAATTGTAGAGATGCTGAAGAACAAATACCCAATGTACCCAATCTCGGACAAATnnnnnnnnnnnnnnnGNAATGACNTNNNGCACACTATGNNNANTAGTANNAnnnnnnnnCTGGGA


Protein sequences

Name Description Sequence
Pgl.942 translated coding region predicted by ESTScan from UniGene Pgl.942

LAEKMSEVCVTGGTGFIAAYLVLNLLQKGYRVRTTVRNPDNVEKFSYLWDLPGAKERLKIVRADLLEEGSFDAAVEGVDGVFHTASPVLVPYNERLKETLIDPCVKGTLNVLRSCSRSPSVKRVVITSSCSSIRYDYNSPERSPLDESHWSNLDYCKKYNLWYAYAKTIAEKEAWKFAEEQGLNLVVVNPSFVIGPLLAPEPTSTLFVVLSIIKGENNKVYPNSRMGFVHIDDVVEAHILAMEAPSASGRIICSADVAHWKEIVEMLKNKYPMYPISDKXXXXXXNDXXHTMXXSXXXXLG

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366:SF9
2-279 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

AEKMSEVCVTGGTGFIAAYLVLNLLQKGYRVRTTVRNPDNVEKFSYLWDLPGAKERLKIVRADLLEEGSFDAAVEGVDGVFHTASPVLVPYNERLKETLIDPCVKGTLNVLRSCSRSPSVKRVVITSSCSSIRYDYNSPERSPLDESHWSNLDYCKKYNLWYAYAKTIAEKEAWKFAEEQGLNLVVVNPSFVIGPLLAPEPTSTLFVVLSIIKGENNKVYPNSRMGFVHIDDVVEAHILAMEAPSASGRIICSADVAHWKEIVEMLKNKYPMYPISDK

HMMPanther: PTHR10366
2-279 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

AEKMSEVCVTGGTGFIAAYLVLNLLQKGYRVRTTVRNPDNVEKFSYLWDLPGAKERLKIVRADLLEEGSFDAAVEGVDGVFHTASPVLVPYNERLKETLIDPCVKGTLNVLRSCSRSPSVKRVVITSSCSSIRYDYNSPERSPLDESHWSNLDYCKKYNLWYAYAKTIAEKEAWKFAEEQGLNLVVVNPSFVIGPLLAPEPTSTLFVVLSIIKGENNKVYPNSRMGFVHIDDVVEAHILAMEAPSASGRIICSADVAHWKEIVEMLKNKYPMYPISDK

superfamily: SSF51735
4-282 NAD(P)-binding Rossmann-fold domains

KMSEVCVTGGTGFIAAYLVLNLLQKGYRVRTTVRNPDNVEKFSYLWDLPGAKERLKIVRADLLEEGSFDAAVEGVDGVFHTASPVLVPYNERLKETLIDPCVKGTLNVLRSCSRSPSVKRVVITSSCSSIRYDYNSPERSPLDESHWSNLDYCKKYNLWYAYAKTIAEKEAWKFAEEQGLNLVVVNPSFVIGPLLAPEPTSTLFVVLSIIKGENNKVYPNSRMGFVHIDDVVEAHILAMEAPSASGRIICSADVAHWKEIVEMLKNKYPMYPISDKXXX

Gene3D: G3DSA:3.40.50.720
IPR016040
7-234 no description
NAD(P)-binding domain

EVCVTGGTGFIAAYLVLNLLQKGYRVRTTVRNPDNVEKFSYLWDLPGAKERLKIVRADLLEEGSFDAAVEGVDGVFHTASPVLVPYNERLKETLIDPCVKGTLNVLRSCSRSPSVKRVVITSSCSSIRYDYNSPERSPLDESHWSNLDYCKKYNLWYAYAKTIAEKEAWKFAEEQGLNLVVVNPSFVIGPLLAPEPTSTLFVVLSIIKGENNKVYPNSRMGFVHIDDV

HMMPfam: PF01370
IPR001509
8-251 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGGTGFIAAYLVLNLLQKGYRVRTTVRNPDNVEKFSYLWDLPGAKERLKIVRADLLEEGSFDAAVEGVDGVFHTASPVLVPYNERLKETLIDPCVKGTLNVLRSCSRSPSVKRVVITSSCSSIRYDYNSPERSPLDESHWSNLDYCKKYNLWYAYAKTIAEKEAWKFAEEQGLNLVVVNPSFVIGPLLAPEPTSTLFVVLSIIKGENNKVYPNSRMGFVHIDDVVEAHILAMEAPSASGRI

Seg: seg
280-289 seg

XXXXXXNDXX

Seg: seg
293-299 seg

XXSXXXX






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox