PRGDB00073533 (Pgl.1363)

From PRG Wiki
Jump to: navigation, search
Pgl.1363
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225919003 (GO369062)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Picea glauca

Comment?

GQ03905.B7P1_C07 GQ039 - Stem - Dormant Picea glauca cDNA clone GQ03905_C07 5', mRNA sequence

DNA Sequence

CTTGAATGCCTGTTTTACATTTCTTCATAACCTTGAAGGTGTAGAGGATAATGTGACTTTAAGTATATGCAGGGATGCTACCTTTGTTACCATTGTGAGCTACGGTGATTCAAACTTTGCAAACGACAAAGCAAGCTGTTTTTTTAATGCTCAAGGCCTTGAAGATCAACCGGTCCCAAAAAGAAAAGGGAACGTACTTGCACCAGCGCCTTCAGCATCAATATCTCCTAGTCCAAGCTCAGAGTACTCTCCAATTGCTGCTCATTCAAGTGTAGCTCTTATAAAGAAGACCCACTCCTCGTCGCATTTGGCAGTCATTCTTGGAGTTGGAATTGGAGTTACAGCAGTGTCACTTTCACTTTTATTTCTATTGATACTTTTGATACACAGGAAAATGAGAGAATTGGAGAACTCAGATACTGCAAATCTCTCTCACTGGAATAGAACTTTGAGTTCACATACACGCAGGAACTTACATGAATGGAACAAAGGGCCACAATCCACCTTTAGACGTTTCAGCCGCAGGGAGATTAGAAGGGCAACTGATGATTTCAGCACAATTATTGGCAAGGGAGGATTTGGCACAGTTTATAAAGCCCGATTTAAAGATGGACTTGTTGCTGCTGTGAAGCGAATGAACAAGATTGCTCAACAAGATGAATTCTGTAAAGAGATGGAGCTATTAGGGAGGTTGCATCATCGGCATCTTGTCACATTAATAGGATTTTGTGCAGAGCAGCATGAAAGGTTTCTCGTTTATGAATACATGGAAAATGGAAGTCTAAAAGAGCATCTTCAAGCTCCCATAAAGACTCCCTTGAATTGGCGGATCAGAATTCAAATTGCCATAGACGTGGCTGCAGCTTTGGAGTACCTTCATTTTTACTGTGATCCACCTTTATGTC


Protein sequences

Name Description Sequence
Pgl.1363 translated coding region predicted by ESTScan from UniGene Pgl.1363

XLNACFTFLHNLEGVEDNVTLSICRDATFVTIVSYGDSNFANDKASCFFNAQGLEDQPVPKRKGNVLAPAPSASISPSPSSEYSPIAAHSSVALIKKTHSSSHLAVILGVGIGVTAVSLSLLFLLILLIHRKMRELENSDTANLSHWNRTLSSHTRRNLHEWNKGPQSTFRRFSRREIRRATDDFSTIIGKGGFGTVYKARFKDGLVAAVKRMNKIAQQDEFCKEMELLGRLHHRHLVTLIGFCAEQHERFLVYEYMENGSLKEHLQAPIKTPLNWRIRIQIAIDVAAALEYLHFYCDPPLCX

Domains

Domain Start-End Description Sequence

Seg: seg
68-88 seg

APAPSASISPSPSSEYSPIAA

HMMPanther: PTHR24420:SF429
69-302 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

PAPSASISPSPSSEYSPIAAHSSVALIKKTHSSSHLAVILGVGIGVTAVSLSLLFLLILLIHRKMRELENSDTANLSHWNRTLSSHTRRNLHEWNKGPQSTFRRFSRREIRRATDDFSTIIGKGGFGTVYKARFKDGLVAAVKRMNKIAQQDEFCKEMELLGRLHHRHLVTLIGFCAEQHERFLVYEYMENGSLKEHLQAPIKTPLNWRIRIQIAIDVAAALEYLHFYCDPPLC

HMMPanther: PTHR24420
69-302 FAMILY NOT NAMED,FAMILY NOT NAMED

PAPSASISPSPSSEYSPIAAHSSVALIKKTHSSSHLAVILGVGIGVTAVSLSLLFLLILLIHRKMRELENSDTANLSHWNRTLSSHTRRNLHEWNKGPQSTFRRFSRREIRRATDDFSTIIGKGGFGTVYKARFKDGLVAAVKRMNKIAQQDEFCKEMELLGRLHHRHLVTLIGFCAEQHERFLVYEYMENGSLKEHLQAPIKTPLNWRIRIQIAIDVAAALEYLHFYCDPPLC

Seg: seg
118-129 seg

SLSLLFLLILLI

superfamily: SSF56112
IPR011009
155-302 Protein kinase-like (PK-like)
Protein kinase-like domain

TRRNLHEWNKGPQSTFRRFSRREIRRATDDFSTIIGKGGFGTVYKARFKDGLVAAVKRMNKIAQQDEFCKEMELLGRLHHRHLVTLIGFCAEQHERFLVYEYMENGSLKEHLQAPIKTPLNWRIRIQIAIDVAAALEYLHFYCDPPLC

Gene3D: G3DSA:3.30.200.20
165-242 no description

GPQSTFRRFSRREIRRATDDFSTIIGKGGFGTVYKARFKDGLVAAVKRMNKIAQQDEFCKEMELLGRLHHRHLVTLIG

Seg: seg
171-180 seg

RRFSRREIRR

ProfileScan: PS50011
IPR000719
183-303 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

DDFSTIIGKGGFGTVYKARFKDGLVAAVKRMNKIAQQDEFCKEMELLGRLHHRHLVTLIGFCAEQHERFLVYEYMENGSLKEHLQAPIKTPLNWRIRIQIAIDVAAALEYLHFYCDPPLCX

HMMSmart: SM00219
IPR020635
183-302 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

DDFSTIIGKGGFGTVYKARFKDGLVAAVKRMNKIAQQDEFCKEMELLGRLHHRHLVTLIGFCAEQHERFLVYEYMENGSLKEHLQAPIKTPLNWRIRIQIAIDVAAALEYLHFYCDPPLC

HMMSmart: SM00220
IPR002290
183-301 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

DDFSTIIGKGGFGTVYKARFKDGLVAAVKRMNKIAQQDEFCKEMELLGRLHHRHLVTLIGFCAEQHERFLVYEYMENGSLKEHLQAPIKTPLNWRIRIQIAIDVAAALEYLHFYCDPPL

HMMPfam: PF07714
IPR001245
186-294 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

STIIGKGGFGTVYKARFKDGLVAAVKRMNKIAQQDEFCKEMELLGRLHHRHLVTLIGFCAEQHERFLVYEYMENGSLKEHLQAPIKTPLNWRIRIQIAIDVAAALEYLH

PatternScan: PS00107
IPR017441
189-211 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGKGGFGTVYKARFKDGLVAAVK

Gene3D: G3DSA:1.10.510.10
243-294 no description

FCAEQHERFLVYEYMENGSLKEHLQAPIKTPLNWRIRIQIAIDVAAALEYLH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox