PRGDB00073534 (Pgl.1445)

From PRG Wiki
Jump to: navigation, search
Pgl.1445
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157620768 (EX421850)
Gene Class T
Domain Type TIR, LRR
Gene Species Picea glauca

Comment?

GQ03719.B7_N22 GQ037 - Shoot tip - Dormant Picea glauca cDNA clone GQ03719_N22 5', mRNA sequence

DNA Sequence

GGGGGATCACACTGAGCCAGGCCCAAGCCTCCTTGCTCTCCTTCTCAGCCCAGGCGATCATGATCACCTTCCGCTCTCCCCATCTTCGCCCCACTCTACCCGCTCTCCCAATCTTCATCGTTGAGTATGTGGGGAGGACGCCTGTGCGCCTCCCTTCACGGGGCGTTTCCAATAGACTCCTGGAAGAGTCGGCTGCTTCAATTCCAATCGCGATTGCAATGGAATTAGGAAGGAGCAGACACAGGAAATTCAAAATATACGACGTGTCTCTGAGCTTCAAAGGACGCGATGTGAGGAGAGGCTTTGCCGATCATCTCTACAACGCCCTCACCAGGGGGGGTTTGCACGAATTCCTTGACACCCACCAAATCAATGGGGGAGAGGACATCTCTGCAAGCTTACAAAACGCAGTTGAGGTGAGTCGCATCCTGATTGCACAATCTGCCTGGTGCCTCAGGGAAGCCTTCCTGATCGCGCAGCAAGTACTACTTCAAGGGAAGGAGGAGTCGACCATCGCCATTCCTCTATTTCACAGCGTGACTCCTGAGCTAAAGAAATTGGTGATTGGAAGGATTGTGTCTTCCAACATTGCCGTCTATCTGAGTGGTCACTCCAAGAAGACACGAATAGGAGGTTAACTAATTCTTCGCTGCTCTGTTGCTTTTTATTTATTTATTCGTATACATGTTTTGTTTATCTAAATCACACTGTTTGTGCGTTTGTATGGGTGTACTGTTTGTGCGTTTGTATGGGTGTAGATCGATTAATAAGTGTTGTGTATATGAAAGGAAATGTTTGTATTGGTTTAGATTGATTAATAAATGTCGTATATATGAAAGGAAATTTGTAAATGGAAGTTTACAATTTAATTCTCGGACTGAGGGCTGCGTGGATGCACCTA


Protein sequences

Name Description Sequence
Pgl.1445 translated coding region predicted by ESTScan from UniGene Pgl.1445

XGITLSQAQASLLSFSAQAIMITFRSPHLRPTLPALPIFIVEYVGRTPVRLPSRGVSNRLLEESAASIPIAIAMELGRSRHRKFKIYDVSLSFKGRDVRRGFADHLYNALTRGGLHEFLDTHQINGGEDISASLQNAVEVSRILIAQSAWCLREAFLIAQQVLLQGKEESTIAIPLFHSVTPELKKLVIGRIVSSNIAVYLSGHSKKTRIGG

Domains

Domain Start-End Description Sequence

Seg: seg
5-19 seg

LSQAQASLLSFSAQA

Seg: seg
64-73 seg

SAASIPIAIA

superfamily: SSF52200
IPR000157
75-182 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

ELGRSRHRKFKIYDVSLSFKGRDVRRGFADHLYNALTRGGLHEFLDTHQINGGEDISASLQNAVEVSRILIAQSAWCLREAFLIAQQVLLQGKEESTIAIPLFHSVTP

ProfileScan: PS50104
IPR000157
85-145 TIR
Toll-Interleukin receptor

KIYDVSLSFKGRDVRRGFADHLYNALTRGGLHEFLDTHQINGGEDISASLQNAVEVSRILI

Gene3D: G3DSA:3.40.50.10140
85-183 no description

KIYDVSLSFKGRDVRRGFADHLYNALTRGGLHEFLDTHQINGGEDISASLQNAVEVSRILIAQSAWCLREAFLIAQQVLLQGKEESTIAIPLFHSVTPE

HMMSmart: SM00255
IPR000157
86-207 Toll
Toll/interleukin-1 receptor homology (TIR) domain

IYDVSLSFKGRDVRRGFADHLYNALTRGGLHEFLDTHQINGGEDISASLQNAVEVSRILIAQSAWCLREAFLIAQQVLLQGKEESTIAIPLFHSVTPELKKLVIGRIVSSNIAVYLSGHSKK

HMMPfam: PF01582
IPR000157
91-186 TIR
Toll-Interleukin receptor

LSFKGRDVRRGFADHLYNALTRGGLHEFLDTHQINGGEDISASLQNAVEVSRILIAQSAWCLREAFLIAQQVLLQGKEESTIAIPLFHSVTPELKK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox