PRGDB00073546 (Pgl.2198)

From PRG Wiki
Jump to: navigation, search
Pgl.2198
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157622547 (EX423629)
Gene Class T
Domain Type TIR, LRR
Gene Species Picea glauca

Comment?

GQ03805.B7_M15 GQ038 - Stem - Active growth Picea glauca cDNA clone GQ03805_M15 5', mRNA sequence

DNA Sequence

CACCTTATCGACAGTGTTTCCTTGCAACAATCCTCATAGGGTTTCTCTGCTCTTCCCTAACTTGTAATTATTCTTGGCCTGGGCAATTGGTCCGACCATCCTTCACTCCGTTTCCATTTCTATTTTCCCATCAGCAATGGCTGCATCGTCCTCGACCGCTGTTAATCCGGACGAGAATTACTACTCTGATGTGTTTATAAATTATCGGGGTCCCGATGTGAAGAAAACCTTCGCCAACTATCTCTACCGTCGCCTTCTTTCACATGGATTGAGTGTGTTTCTGGACCAGCAAGAATTTCAACAGGGAGAGAATCTAACTTGTCAAATAGAAGGGGCTATCCGATCAGCCTTCGTCCATGTGACCAttttttttGCTGGAAATGCTCATTCAAAATGGTGTCTAAATGAACTTCTCCTCATGTTGGACTCAAAGGCTTACATTATTCCAGTGTTTTACAATGTGAAGCCCGTTGATCTTCGGTGGACGCGGGGCAAAGATGGAGTGTATGCTCAAGCCCTAGAGAAACTCGAAAAGAAGAGGACGTATGCCCTTTCTCTAGTTGCAGAAGAGATAAGCGGTTTCGAGCTGGAGGCGTGTAATGGCCACGAGAGAGAGCTGCTAGATAAGGTGGTTGAACGTGTGACTAAAAAGGTGAAACAACCAGACTTAGACGTGGCCAAATATCCAAGTATGGATGAGAAGATCATGTGAATCTTGATGCACTTTTACAAGAGGTGCCCGGGGTTGAACAGTTAAAGTCCTTGGACGAGTGGTATGCAAGTGGATATGTGAAGCTGAAGATGAGATAGAAAGACTTCCTGTATCTTTAGAGGAGTTGCGGGTATCTGGATGTGTGACACTGAATATCATAGGGGGGTTGGCGCAATTGACAAAGCTTCCAAGTCTACATGTTACTGGATGCTC


Protein sequences

Name Description Sequence
Pgl.2198 translated coding region predicted by ESTScan from UniGene Pgl.2198

MAASSSTAVNPDENYYSDVFINYRGPDVKKTFANYLYRRLLSHGLSVFLDQQEFQQGENLTCQIEGAIRSAFVHVTIFFAGNAHSKWCLNELLLMLDSKAYIIPVFYNVKPVDLRWTRGKDGVYAQALEKLEKKRTYALSLVAEEISGFELEACNGHERELLDKVVERVTKKVKQPDLDVAKYPSMDXEDHVNLDALLQEVPGVEQLKSLDEWYASGYXEAEDEIERLPVSLEELRVSGCVTLNIIGGLAQLTKLPSLHVTGCS

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
5-149 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

SSTAVNPDENYYSDVFINYRGPDVKKTFANYLYRRLLSHGLSVFLDQQEFQQGENLTCQIEGAIRSAFVHVTIFFAGNAHSKWCLNELLLMLDSKAYIIPVFYNVKPVDLRWTRGKDGVYAQALEKLEKKRTYALSLVAEEISGF

ProfileScan: PS50104
IPR000157
15-111 TIR
Toll-Interleukin receptor

YYSDVFINYRGPDVKKTFANYLYRRLLSHGLSVFLDQQEFQQGENLTCQIEGAIRSAFVHVTIFFAGNAHSKWCLNELLLMLDSKAYIIPVFYNVKP

Gene3D: G3DSA:3.40.50.10140
15-119 no description

YYSDVFINYRGPDVKKTFANYLYRRLLSHGLSVFLDQQEFQQGENLTCQIEGAIRSAFVHVTIFFAGNAHSKWCLNELLLMLDSKAYIIPVFYNVKPVDLRWTRG

HMMSmart: SM00255
IPR000157
16-145 Toll
Toll/interleukin-1 receptor homology (TIR) domain

YSDVFINYRGPDVKKTFANYLYRRLLSHGLSVFLDQQEFQQGENLTCQIEGAIRSAFVHVTIFFAGNAHSKWCLNELLLMLDSKAYIIPVFYNVKPVDLRWTRGKDGVYAQALEKLEKKRTYALSLVAEE

HMMPfam: PF01582
IPR000157
19-134 TIR
Toll-Interleukin receptor

VFINYRGPDVKKTFANYLYRRLLSHGLSVFLDQQEFQQGENLTCQIEGAIRSAFVHVTIFFAGNAHSKWCLNELLLMLDSKAYIIPVFYNVKPVDLRWTRGKDGVYAQALEKLEKK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox