PRGDB00073548 (Pgl.2455)

From PRG Wiki
Jump to: navigation, search
Pgl.2455
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 211891026 (DV988105)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Picea glauca

Comment?

GQ02016.TB_C19 GQ020: Clean ROOTS systems -Diurnal cycle Picea glauca cDNA clone GQ02016_C19 3', mRNA sequence

DNA Sequence

ATAAAAACCAGCAGTAGAGGCCAGTGCCAAGAATATAGTGAGGCCTAACATTTCTGGCTGCAATTACAAATATACAAACAACATGAATAGACAGGGAGATTGCAATTATCTCAGACTCATTTAACTGCTTTTAGTGCCTCTCAAACAGTGGAGAACAAGAAGAAGGAAGCAATATTTATGAGCCTCCACCTCCACTGGCAGCTAGAACGTGGAGCTCTTTGAACATGGAGACTACCTGAAGCATGCTAGGCCTCCTAGAGGGAAAATCTTCCAGGCATTGCATTGTAATTTGGAGATAGCGCATGACTTCATAATCTGCACCCATGTCCTTCAAGTCTGGATCGATGACCTCCATGGCCTTCCCTTGATTCAGATGGAGCTTCACCCACCCAACCAGATTGCTGTCTCCAAATTCTTCCTTGTCAGTAGGCCTCTTCCCAGTAAGTATTTCAAGCAAAAGGACTCCAAATGAGTAAACATCCCCTTTTGCAGTACATCTGAAGCTCTGGTAATATTCAGGAGGGACATAACCAGGAGTGCCAGCCAGAGTGCTGACACTCAAGTGGGTATCCAGTGCACTGATGAGCCTCGCCATTCCAAAGTCGGAAACTCTGGCTTCCATGTTTCTATCGAGAAGTACATTGCTGGATTTCATGTCCCTGTGAATTATGTGAGGAATGCAGTTATGGTGTAGGAATGCCAGGCCCCTTGCAGCTCCTTTGGCAATCTGTTTTCTCGTTTCCCAGGTGAGGCGGGTTTTAAATCCACCTTTCTCCCCGTGAAGCATGTCTTCCAGGCTCCCGAATTCCATATATTCATAGACCAATAGCCTCTCCTCCCCCACTTTGCAGTAGCCCAACAGAGGCACCAGGTTCCTGTGCTTGATCTTGCCTAGGGTTTCCATTTCTGCCATGAATTCTCTATCCCCTTGGCAGCTCAGGCGGATGAGTTTCTTGATTGCG


Protein sequences

Name Description Sequence
Pgl.2455 translated coding region predicted by ESTScan from UniGene Pgl.2455

XAIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKVGEERLLVYEYMEFGSLEDMLHGEKGGFKTRLTWETRKQIAKGAARGLAFLHHNCIPHIIHRDMKSSNVLLDRNMEARVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSFGVLLLEILTGKRPTDKEEFGDSNLVGWVKLHLNQGKAMEVIDPDLKDMGADYEVMRYLQITMQCLEDFPSRRPSMLQVVSMFKELHVLAASGGGGS

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-255 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XAIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKVGEERLLVYEYMEFGSLEDMLHGEKGGFKTRLTWETRKQIAKGAARGLAFLHHNCIPHIIHRDMKSSNVLLDRNMEARVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSFGVLLLEILTGKRPTDKEEFGDSNLVGWVKLHLNQGKAMEVIDPDLKDMGADYEVMRYLQITMQCLEDFPSRRPSMLQVVSMFKELHVLA

HMMPanther: PTHR24420:SF924
2-251 SUBFAMILY NOT NAMED

AIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKVGEERLLVYEYMEFGSLEDMLHGEKGGFKTRLTWETRKQIAKGAARGLAFLHHNCIPHIIHRDMKSSNVLLDRNMEARVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSFGVLLLEILTGKRPTDKEEFGDSNLVGWVKLHLNQGKAMEVIDPDLKDMGADYEVMRYLQITMQCLEDFPSRRPSMLQVVSMFKEL

HMMPanther: PTHR24420
2-251 FAMILY NOT NAMED,FAMILY NOT NAMED

AIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKVGEERLLVYEYMEFGSLEDMLHGEKGGFKTRLTWETRKQIAKGAARGLAFLHHNCIPHIIHRDMKSSNVLLDRNMEARVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSFGVLLLEILTGKRPTDKEEFGDSNLVGWVKLHLNQGKAMEVIDPDLKDMGADYEVMRYLQITMQCLEDFPSRRPSMLQVVSMFKEL

superfamily: SSF56112
IPR011009
2-248 Protein kinase-like (PK-like)
Protein kinase-like domain

AIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKVGEERLLVYEYMEFGSLEDMLHGEKGGFKTRLTWETRKQIAKGAARGLAFLHHNCIPHIIHRDMKSSNVLLDRNMEARVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSFGVLLLEILTGKRPTDKEEFGDSNLVGWVKLHLNQGKAMEVIDPDLKDMGADYEVMRYLQITMQCLEDFPSRRPSMLQVVSMF

Gene3D: G3DSA:3.30.200.20
2-53 no description

AIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKVGEERLLVYEYME

HMMPfam: PF07714
IPR001245
2-247 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

AIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKVGEERLLVYEYMEFGSLEDMLHGEKGGFKTRLTWETRKQIAKGAARGLAFLHHNCIPHIIHRDMKSSNVLLDRNMEARVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSFGVLLLEILTGKRPTDKEEFGDSNLVGWVKLHLNQGKAMEVIDPDLKDMGADYEVMRYLQITMQCLEDFPSRRPSMLQVVSM

HMMSmart: SM00220
IPR002290
2-248 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

AIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKVGEERLLVYEYMEFGSLEDMLHGEKGGFKTRLTWETRKQIAKGAARGLAFLHHNCIPHIIHRDMKSSNVLLDRNMEARVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSFGVLLLEILTGKRPTDKEEFGDSNLVGWVKLHLNQGKAMEVIDPDLKDMGADYEVMRYLQITMQCLEDFPSRRPSMLQVVSMF

HMMSmart: SM00219
IPR020635
5-248 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

KLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKVGEERLLVYEYMEFGSLEDMLHGEKGGFKTRLTWETRKQIAKGAARGLAFLHHNCIPHIIHRDMKSSNVLLDRNMEARVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSFGVLLLEILTGKRPTDKEEFGDSNLVGWVKLHLNQGKAMEVIDPDLKDMGADYEVMRYLQITMQCLEDFPSRRPSMLQVVSMF

Gene3D: G3DSA:1.10.510.10
54-246 no description

FGSLEDMLHGEKGGFKTRLTWETRKQIAKGAARGLAFLHHNCIPHIIHRDMKSSNVLLDRNMEARVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSFGVLLLEILTGKRPTDKEEFGDSNLVGWVKLHLNQGKAMEVIDPDLKDMGADYEVMRYLQITMQCLEDFPSRRPSMLQVVS

PatternScan: PS00108
IPR008271
99-111 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDMKSSNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox