PRGDB00073549 (Pgl.2486)

From PRG Wiki
Jump to: navigation, search
Pgl.2486
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 49064224 (CO241907)
Gene Class Unknown
Domain Type LRR
Gene Species Picea glauca

Comment?

WS00720.B21_A24 WS-PS-N-A-8 Picea glauca cDNA clone WS00720_A24 3', mRNA sequence

DNA Sequence

ttttttttttttttttttCtaatttatattttattgcaataagttacaatgcctactatgtagggagcatattttgaagcaataagttacaatctttactatgTAGGAAGTCGATACACTCCATAAAAGACTTGTGGCTTTTTGGAGGGTATACCCAACACCCAACACCTAGCTCTTTCCCAGAATATGAACATAGCAACAACTCCCCCAAATCCAAGCCCCATTCCcattcccaatgctattaatgacatattttcattcacagtagtcaaccatttcacttcaacatgagtactcttagtagtactattacctccagtgaaagtaggttttttattttcatttccgcatcgatctaatggacacccccataagcatttattattttgaaatgaagatgcatcaaaagttgaaaattgtgtccctgttggaattggcccgcataggctattagatgaaacatccattttgtgcaaccaatgtagcttagatagttcttgagggatccgtccactcaaattatttttggccaagtccaacacctccaaagtagatatgttACC


Protein sequences

Name Description Sequence
Pgl.2486 translated coding region predicted by ESTScan from UniGene Pgl.2486

GNISTLEVLDLAKNNLSGRIPQELSKLHWLHKMDVSSNSLCGPIPTGTQFSTFDASSFQNNKCLWGCPLDRCGNENKKPTFTGGNSTTKSTHVEVKWLTTVNENMSLIALGMGMGLGFGGVVAMFIFWERARCWVLGIPSKKPQVFYGVYRLPT


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF478
1-66 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

GNISTLEVLDLAKNNLSGRIPQELSKLHWLHKMDVSSNSLCGPIPTGTQFSTFDASSFQNNKCLWG

HMMPanther: PTHR24420
1-66 FAMILY NOT NAMED,FAMILY NOT NAMED

GNISTLEVLDLAKNNLSGRIPQELSKLHWLHKMDVSSNSLCGPIPTGTQFSTFDASSFQNNKCLWG

superfamily: SSF52058
1-73 L domain-like,LRR

GNISTLEVLDLAKNNLSGRIPQELSKLHWLHKMDVSSNSLCGPIPTGTQFSTFDASSFQNNKCLWGCPLDRCG

Gene3D: G3DSA:3.80.10.10
1-69 no description

GNISTLEVLDLAKNNLSGRIPQELSKLHWLHKMDVSSNSLCGPIPTGTQFSTFDASSFQNNKCLWGCPL

HMMPfam: PF00560
IPR001611
6-27 LRR_1
Leucine-rich repeat

LEVLDLAKNNLSGRIPQELSKL

Seg: seg
109-125 seg

ALGMGMGLGFGGVVAMF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox