PRGDB00073551 (Pgl.2565)

From PRG Wiki
Jump to: navigation, search
Pgl.2565
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 211891477 (DV990489)
Gene Class RLP
Domain Type LRR, Ser-Thr Kinase
Gene Species Picea glauca

Comment?

GQ0253.B7_E11 GQ025: Annual flush SHOOTS diurnal cycle- trees Picea glauca cDNA clone GQ0253_E11 3', mRNA sequence

DNA Sequence

CCCCCCTTATCTCTCCGGACATCGCCAACGCCAAAAATCTTTCTCATCTCGACATCAACGGCAATATATTTACCGGCAGCCTGCCTACAGAAATGGGCGAGCTGCGGAACCTCAGCGATATAATCGCCAGCAATAATTTACTGACCGGTGCTTTGCCTTCCAGCTTGTGGAAGCTGCAACTGCTCAGAAAGCTGGACCTTAGCGATAACCAGCTAAGCGGGGAGCTTCTTGCTGATATCAGTTCGTGTAAGCAGCTCGGAGAGATCAATCTTTCGAAAAACCAGTTCTCCGGTTCGATTCCTGCGAGTCTTGGTACTTTGCCGGTGCTTAATTATTTAGACCTCTCGGATAATCTTCTCACCGGGTCCATTCCTTCCGAACTTGGGAATCTGAAGCTGAATACCTTCAATGTCTCGGACAACCGTCTGTCGGGCGCAGTTCCTTTGGCGTTTTTGAGTCCTGTGTATGAGGAGAGCTTTTTGGGAAATCTTGAGTTGTGTAGCCGGGAGGCCTTTAAAGGCACGAAGTCCTGTTCTGAAGAACGAAGTGAAAGAGCTAAGCGCAGGACTTGGTGGTGGCTGCTTCGTTGCTTGTTTGTGTTGTCTCTCATTATTTTCGTCCTTGGACTCGCGTGGTTTTACAGAAGGTACCGAAGCTTTGCAAATGCAGAGAGGAGAAAGCCCGTCGACAAATCTTCGTGGATGCTGACTTCATTTCACAGGCTGGGGTTCAGTGAATATGAGATTCTGGATTGCTTGGACGAAGATAATGTCATTGGGAGCGGCGGAGCCGGTAAGGTTTACAAGGCGACGTTGAGCAATGGTGAATTAGTGGCCATCAAGAGGCTTTGGAGCAGTGCTAAAAGCGACGCTTCCAATGACAATGGTTTCAAAGCAGAGGTGGACACATTGGGAAAGATCAGGCATAAGAACATAGTAAAGCTATGGTGTTGTTGTAGTAATAGCG


Protein sequences

Name Description Sequence
Pgl.2565 translated coding region predicted by ESTScan from UniGene Pgl.2565

XPLISPDIANAKNLSHLDINGNIFTGSLPTEMGELRNLSDIIASNNLLTGALPSSLWKLQLLRKLDLSDNQLSGELLADISSCKQLGEINLSKNQFSGSIPASLGTLPVLNYLDLSDNLLTGSIPSELGNLKLNTFNVSDNRLSGAVPLAFLSPVYEESFLGNLELCSREAFKGTKSCSEERSERAKRRTWWWLLRCLFVLSLIIFVLGLAWFYRRYRSFANAERRKPVDKSSWMLTSFHRLGFSEYEILDCLDEDNVIGSGGAGKVYKATLSNGELVAIKRLWSSAKSDASNDNGFKAEVDTLGKIRHKNIVKLWCCCSNSX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF884
4-321 SUBFAMILY NOT NAMED

ISPDIANAKNLSHLDINGNIFTGSLPTEMGELRNLSDIIASNNLLTGALPSSLWKLQLLRKLDLSDNQLSGELLADISSCKQLGEINLSKNQFSGSIPASLGTLPVLNYLDLSDNLLTGSIPSELGNLKLNTFNVSDNRLSGAVPLAFLSPVYEESFLGNLELCSREAFKGTKSCSEERSERAKRRTWWWLLRCLFVLSLIIFVLGLAWFYRRYRSFANAERRKPVDKSSWMLTSFHRLGFSEYEILDCLDEDNVIGSGGAGKVYKATLSNGELVAIKRLWSSAKSDASNDNGFKAEVDTLGKIRHKNIVKLWCCCSN

HMMPanther: PTHR24420
4-321 FAMILY NOT NAMED,FAMILY NOT NAMED

ISPDIANAKNLSHLDINGNIFTGSLPTEMGELRNLSDIIASNNLLTGALPSSLWKLQLLRKLDLSDNQLSGELLADISSCKQLGEINLSKNQFSGSIPASLGTLPVLNYLDLSDNLLTGSIPSELGNLKLNTFNVSDNRLSGAVPLAFLSPVYEESFLGNLELCSREAFKGTKSCSEERSERAKRRTWWWLLRCLFVLSLIIFVLGLAWFYRRYRSFANAERRKPVDKSSWMLTSFHRLGFSEYEILDCLDEDNVIGSGGAGKVYKATLSNGELVAIKRLWSSAKSDASNDNGFKAEVDTLGKIRHKNIVKLWCCCSN

Gene3D: G3DSA:3.80.10.10
4-151 no description

ISPDIANAKNLSHLDINGNIFTGSLPTEMGELRNLSDIIASNNLLTGALPSSLWKLQLLRKLDLSDNQLSGELLADISSCKQLGEINLSKNQFSGSIPASLGTLPVLNYLDLSDNLLTGSIPSELGNLKLNTFNVSDNRLSGAVPLAF

superfamily: SSF52058
4-151 L domain-like,LRR

ISPDIANAKNLSHLDINGNIFTGSLPTEMGELRNLSDIIASNNLLTGALPSSLWKLQLLRKLDLSDNQLSGELLADISSCKQLGEINLSKNQFSGSIPASLGTLPVLNYLDLSDNLLTGSIPSELGNLKLNTFNVSDNRLSGAVPLAF

Seg: seg
54-69 seg

SSLWKLQLLRKLDLSD

HMMPfam: PF13516
60-81 LRR_6,Leucine Rich repeat

QLLRKLDLSDNQLSGELLADIS

FPrintScan: PR00019
62-75 LEURICHRPT,Leucine-rich repeat signature

LRKLDLSDNQLSGE

FPrintScan: PR00019
107-120 LEURICHRPT,Leucine-rich repeat signature

LPVLNYLDLSDNLL

HMMPfam: PF00560
IPR001611
110-131 LRR_1
Leucine-rich repeat

LNYLDLSDNLLTGSIPSELGNL

superfamily: SSF56112
IPR011009
223-319 Protein kinase-like (PK-like)
Protein kinase-like domain

AERRKPVDKSSWMLTSFHRLGFSEYEILDCLDEDNVIGSGGAGKVYKATLSNGELVAIKRLWSSAKSDASNDNGFKAEVDTLGKIRHKNIVKLWCCC

Gene3D: G3DSA:3.30.200.20
253-321 no description

LDEDNVIGSGGAGKVYKATLSNGELVAIKRLWSSAKSDASNDNGFKAEVDTLGKIRHKNIVKLWCCCSN

ProfileScan: PS50011
IPR000719
253-323 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LDEDNVIGSGGAGKVYKATLSNGELVAIKRLWSSAKSDASNDNGFKAEVDTLGKIRHKNIVKLWCCCSNSX

HMMPfam: PF00069
IPR017442
257-320 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

NVIGSGGAGKVYKATLSNGELVAIKRLWSSAKSDASNDNGFKAEVDTLGKIRHKNIVKLWCCCS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox