PRGDB00073554 (Pgl.2935)

From PRG Wiki
Jump to: navigation, search
Pgl.2935
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 49062114 (CO239797)
Gene Class T
Domain Type TIR, LRR
Gene Species Picea glauca

Comment?

WS0076.B21_J20 WS-PS-N-A-8 Picea glauca cDNA clone WS0076_J20 3', mRNA sequence

DNA Sequence

ttttttttttttttttttAGCCCTTCAAATCCTTTTTCCCTTGATCTCATTGACACTGGATATTGTTGGCTTTTTGGCAAGCCAATTCTAGACATATGCTCAACTAAGTTACGAAAGCTTAAAAGCAAATGACTTGACTTTGAGACTTAGTAGTGTTTGGAAATTTCTTGTTAGTCCTAACAAGTCCCTTTTCCCTAGTCTCTTATACTTTGGAGGCTTCCCAGTGGATATCGTCAACATGATTAATGAAGCCCCCAGTTCATTAATTGCTCATCATTTTGTTGGCACCCTCGCTTTTATTCATCCCACAGGAAAAGATATAGTTGGACGAACTTCGCATGAAGTGATGGTCCATCTTTGGCTGCAAGAGGGACAATACATAACTCCTCAAATTGACAGCGCCGTTAGAACAGCCTCTGTACATATAGCAATTTTCTCGCCTGGTTATGCGAAGTCAAAATGGTGTTTAGACGAGCTAGTACTGATGGTGGAGACTATGTCCAAGTCGAAGTCCACCATTATCCCGGTCTTCTACGGTGTCGAGCCTGCAGATCTTCGGTGGACGCAGAGCAAAGATGGAGTCTACGCTCGAGCCCTCTGCGTGCTCGAAAAGAAAATAACATTTGATGGTCAACAACGACATGACTCCAGCGCAATTGATAAATGGAGGAATGCTCTCTCTCAAGTTGCAGATATAAAAGGTTTTGACCTAAATACGTATGACCT


Protein sequences

Name Description Sequence
Pgl.2935 translated coding region predicted by ESTScan from UniGene Pgl.2935

MINEAPSSLIAHHFVGTLAFIHPTGKDIVGRTSHEVMVHLWLQEGQYITPQIDSAVRTASVHIAIFSPGYAKSKWCLDELVLMVETMSKSKSTIIPVFYGVEPADLRWTQSKDGVYARALCVLEKKITFDGQQRHDSSAIDKWRNALSQVADIKGFDLNTYDL

Domains

Domain Start-End Description Sequence

HMMSmart: SM00255
IPR000157
6-153 Toll
Toll/interleukin-1 receptor homology (TIR) domain

PSSLIAHHFVGTLAFIHPTGKDIVGRTSHEVMVHLWLQEGQYITPQIDSAVRTASVHIAIFSPGYAKSKWCLDELVLMVETMSKSKSTIIPVFYGVEPADLRWTQSKDGVYARALCVLEKKITFDGQQRHDSSAIDKWRNALSQVADI

superfamily: SSF52200
IPR000157
42-156 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

LQEGQYITPQIDSAVRTASVHIAIFSPGYAKSKWCLDELVLMVETMSKSKSTIIPVFYGVEPADLRWTQSKDGVYARALCVLEKKITFDGQQRHDSSAIDKWRNALSQVADIKGF

Gene3D: G3DSA:3.40.50.10140
42-123 no description

LQEGQYITPQIDSAVRTASVHIAIFSPGYAKSKWCLDELVLMVETMSKSKSTIIPVFYGVEPADLRWTQSKDGVYARALCVL

HMMPfam: PF01582
IPR000157
43-148 TIR
Toll-Interleukin receptor

QEGQYITPQIDSAVRTASVHIAIFSPGYAKSKWCLDELVLMVETMSKSKSTIIPVFYGVEPADLRWTQSKDGVYARALCVLEKKITFDGQQRHDSSAIDKWRNALS

ProfileScan: PS50104
IPR000157
45-153 TIR
Toll-Interleukin receptor

GQYITPQIDSAVRTASVHIAIFSPGYAKSKWCLDELVLMVETMSKSKSTIIPVFYGVEPADLRWTQSKDGVYARALCVLEKKITFDGQQRHDSSAIDKWRNALSQVADI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox