PRGDB00073556 (Pgl.3041)

From PRG Wiki
Jump to: navigation, search
Pgl.3041
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157565891 (EX367119)
Gene Class Unknown
Domain Type
Gene Species Picea glauca

Comment?

GQ03212.B7_G20 GQ032 - Shoot tip (Normalized library) Picea glauca cDNA clone GQ03212_G20 5', mRNA sequence

DNA Sequence

ACCAGGGAGAAATCAACTATTTGTTCCGGGGCCCGTCAATATTCCGGAACCTGTTCTGCAGGCTATGAATAGAAACAATGAGGACTACCGCGCTCCACCAGTGCCAGCTCTCACAAAGAAACTTCTTGCTGACGTACCGAAAATATTCAAATCCACCACAGGCACCCCTTTCTTATTTCCTACTACGGGTACTGGTGCTTGGGAAAGTGCTCTTACAAACACACTGTCACCACGAGATCGAATCATCTCTTTTGAGATGGGCCAGTTCAGTCTTCTGTGGATTGATCAAATGAAACGCCTCAACTTTGATGTTGATGTTGTACACTGTGAATGGGGGACAGGGGTGGATCTTGGGATACTAAGGACAAAGCTTGAAGCAGATAAGGAACATAAAGTAAGGGCTATTTGCTGTGTTCACAATGAGACTGCAACGGGCGTCACAAACAATTTGGCAGCTATAAGGACGGTGATCGATGATTGCATGCATCCTGCTTTGTTTCTGGTGGATGGCGTGTCTTCTGTATGTGCCATTGATTTCCGTATGGATGAATGGGGAGTGGATGTAGCGCTAACAGGTTCTCAAAAAGCTCTGTCCTTGCCAACAGGTCTTGGTATTGTCTGTGCAAGCCCAAAGGCCTTAGAAGCAACAAAGACTGCAAAGTCGTTGAGGGTATTTTTTGACTGGAACGACTATTTGAAGTTCTATAAGTTGGGGACGTATTGGCCCTACACACCATCAATTCAACTCCTATATGGACTAAGGACAGCATTAGACCTTATATTTTTGGAAGGCTTAGATAACGTCATTGCAAGGCACAGTCGCTTAGGAAGGGCAACAAGGCTTGCTGTGGAAGCATGGGGGTTGAAGAACTGCACTCAAAGGGAGGAATGGTACAGTGACACTGGTACAGCAGTAGTTATTCCCCCTTATATTGACAGT


Protein sequences

Name Description Sequence
Pgl.3041 translated coding region predicted by ESTScan from UniGene Pgl.3041

XPGRNQLFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTGTPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTGVDLGILRTKLEADKEHKVRAICCVHNETATGVTNNLAAIRTVIDDCMHPALFLVDGVSSVCAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHSRLGRATRLAVEAWGLKNCTQREEWYSDTGTAVVIPPYIDS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152:SF7
1-314 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

XPGRNQLFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTGTPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTGVDLGILRTKLEADKEHKVRAICCVHNETATGVTNNLAAIRTVIDDCMHPALFLVDGVSSVCAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHSRLGRATRLAVEAWGLKNCTQREEWYSDTGTAVVIPPYIDS

HMMPanther: PTHR21152
1-314 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

XPGRNQLFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTGTPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTGVDLGILRTKLEADKEHKVRAICCVHNETATGVTNNLAAIRTVIDDCMHPALFLVDGVSSVCAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHSRLGRATRLAVEAWGLKNCTQREEWYSDTGTAVVIPPYIDS

superfamily: SSF53383
IPR015424
2-313 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

PGRNQLFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTGTPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTGVDLGILRTKLEADKEHKVRAICCVHNETATGVTNNLAAIRTVIDDCMHPALFLVDGVSSVCAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHSRLGRATRLAVEAWGLKNCTQREEWYSDTGTAVVIPPYID

HMMPfam: PF00266
IPR000192
7-290 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

LFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTGTPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTGVDLGILRTKLEADKEHKVRAICCVHNETATGVTNNLAAIRTVIDDCMHPALFLVDGVSSVCAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHSRLGRATRLAVEAWGLK

Gene3D: G3DSA:3.40.640.10
IPR015421
16-251 no description
Pyridoxal phosphate-dependent transferase, major r

PEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTGTPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTGVDLGILRTKLEADKEHKVRAICCVHNETATGVTNNLAAIRTVIDDCMHPALFLVDGVSSVCAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLL

Seg: seg
53-66 seg

TTGTPFLFPTTGTG

PatternScan: PS00595
IPR020578
187-207 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

VDVALTGSQKALSLPTGLGIV

Gene3D: G3DSA:3.90.1150.10
IPR015422
252-313 no description
Pyridoxal phosphate-dependent transferase, major r

YGLRTALDLIFLEGLDNVIARHSRLGRATRLAVEAWGLKNCTQREEWYSDTGTAVVIPPYID






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox