PRGDB00073558 (Pgl.3064)

From PRG Wiki
Jump to: navigation, search
Pgl.3064
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157566002 (EX367230)
Gene Class Unknown
Domain Type
Gene Species Picea glauca

Comment?

GQ03212.B7_L16 GQ032 - Shoot tip (Normalized library) Picea glauca cDNA clone GQ03212_L16 5', mRNA sequence

DNA Sequence

ATGCTAATAGTTGTTGCTGGTTCTCGTGAAGCTTCATTCATGCTGTTGGAACCCGGCCTATCACTCTGAAAGCTAGGAAAATGTCGATTGCACATTTCATTTTCGGGATCTTCGGGAATATCACTGCCCTGACACTCTTCTTAGCTCCCTTGATTACCTTCTGGACGATTATCAAGAACAAATCGACGGAACAGTTCTCTGGATTTCCTTATGTTTCTACACTTTTGAATTGCTTGCTTTCTGCATGGTATGGCCTGCCGTTTGTATCGCCCAATAATCTTCTCGTGAGCACAGTTAATGGAACTGGAGCCGCCATTGAACTCTGCTACGTGATTGTGTTCCTCTTCTATATTCGAGACAAGAAATACAGGGTGAAAATATTTGCTCTTCTGGTAATTGTGCTCAAGTTTTTTGCGCTGGTGGCCCTGGTATCGCTCTTGGCGCTGCATGGACATGCAAGGAAGTTATTTTGTGGCTTTGCTGCCGCCATCTTCTCCATCTGCATGTACGCGTCTCCTCTGTCCATAATGAGGACGGTGATTAAGACGAAGAGCGTAAAGTATATGCCGTTCTTCCTGTCTCTCTGTGTTTTTCTTTGCGGCACGTCCTGGTTTATCTTCGGCCTACTGGGAAAGGATCCATTCGTTGCTGTACCGAATGAAGTTGGAAGTGCGCTAGGAGCAATGCAGCTGATTCTGTACGCTGTTTACAAAGACTGGAAGAAGAAGGACAGTAACACATCGTCTCCTCCTGTACAGGAGGGAAAGGCAGGGGCCGATCACATGAACGCAATGGAAATGGGATCTTATGGGCAGACAGAAGCCCATAATCCTTCTGGGAAATATGTGAATGGTTTTTGAATTCCATGAGCAAATTGATCAAACTTATAGCTCCAAGCCCTTGAGGCTGAGGAAACACGAGAGCTACTCTATCTCATAGCTTTAAAGGGACTCAAAACCTGGAATAACCTGCTGCATGGGCGT


Protein sequences

Name Description Sequence
Pgl.3064 translated coding region predicted by ESTScan from UniGene Pgl.3064

XANSCCWFSXSFIHAVGTRPITLKARKMSIAHFIFGIFGNITALTLFLAPLITFWTIIKNKSTEQFSGFPYVSTLLNCLLSAWYGLPFVSPNNLLVSTVNGTGAAIELCYVIVFLFYIRDKKYRVKIFALLVIVLKFFALVALVSLLALHGHARKLFCGFAAAIFSICMYASPLSIMRTVIKTKSVKYMPFFLSLCVFLCGTSWFIFGLLGKDPFVAVPNEVGSALGAMQLILYAVYKDWKKKDSNTSSPPVQEGKAGADHMNAMEMGSYGQTEAHNPSGKYVNGF


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10791
IPR004316
33-251 RAG1-ACTIVATING PROTEIN 1
RAG1-activating protein-1-related

FIFGIFGNITALTLFLAPLITFWTIIKNKSTEQFSGFPYVSTLLNCLLSAWYGLPFVSPNNLLVSTVNGTGAAIELCYVIVFLFYIRDKKYRVKIFALLVIVLKFFALVALVSLLALHGHARKLFCGFAAAIFSICMYASPLSIMRTVIKTKSVKYMPFFLSLCVFLCGTSWFIFGLLGKDPFVAVPNEVGSALGAMQLILYAVYKDWKKKDSNTSSPP

HMMPfam: PF03083
IPR004316
34-121 MtN3_slv
RAG1-activating protein-1-related

IFGIFGNITALTLFLAPLITFWTIIKNKSTEQFSGFPYVSTLLNCLLSAWYGLPFVSPNNLLVSTVNGTGAAIELCYVIVFLFYIRDK

Seg: seg
128-149 seg

FALLVIVLKFFALVALVSLLAL

HMMPfam: PF03083
IPR004316
158-239 MtN3_slv
RAG1-activating protein-1-related

CGFAAAIFSICMYASPLSIMRTVIKTKSVKYMPFFLSLCVFLCGTSWFIFGLLGKDPFVAVPNEVGSALGAMQLILYAVYKD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox