PRGDB00073560 (Pgl.3142)

From PRG Wiki
Jump to: navigation, search
Pgl.3142
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225912363 (GO365959)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Picea glauca

Comment?

GQ03607.B7P1_A02 GQ036 - Shoot tip - Active growth Picea glauca cDNA clone GQ03607_A02 5', mRNA sequence

DNA Sequence

TGAAGATGACATGAATTTGAAGATGAGCATGAATTAGACAGAGAGTATCTGAAGAATCTCACCGGCCTTCCCACGATTTTCACTTACAAGAGTATCGAGACCGCCACAGGCAGATTTAGCAAAGAGATCGGAAAGGGTGGATTTGGGAAAGTATACGAAGGAAAATTGAGTGATGGTATTCCGGTGGCTGTCAAATGTCTGGGGGACTGGGCAGGGCAGGGACAGAGAGAGTTTTGTGCAGAAATCGCCACCATATCTTCCGTCAATCATTCCAATCTGGTGAGCTTGCGTGGTCTTTGTGTAGAAGGGCAACATCGAATTCTGGTGTACGAATTCATGGCCAACGGGTCTCTTGATAGATGGCTGTTTGGTTCAGACAAACAGTTGGATTGGAAGACCAGATATTCGATTGCGCTCGAGACCGCCCGGGGACTTGCTTACCTGCACGAGGATTCGAGGCTTTGTATTCTCCATCTCGACATCAAACCGCAGAACATTCTGCTGAACGAGAATTTCAGGGCGAAAGTCTCCGATTTCGGCATGGCGAGGTCTATGGATAGAGATATAGAAAGCCGTGTGGTGACTCAAGCGAGAGGGACGCTGGGGTACATGGCACCCGAGTGGTTTTATGAAGTTGGAATCACTTCCAAGAGCGATGTGTTCAGCTATGGGATGGTGCTTCTGGAGATCGTCAGCGGGCGCAAGAACCTGGATAGTTCTCAGGATTCGGAGCACTGTTTTTTCCCTTCTATTGCTTTG


Protein sequences

Name Description Sequence
Pgl.3142 translated coding region predicted by ESTScan from UniGene Pgl.3142

XRXHEFEDEHELDREYLKNLTGLPTIFTYKSIETATGRFSKEIGKGGFGKVYEGKLSDGIPVAVKCLGDWAGQGQREFCAEIATISSVNHSNLVSLRGLCVEGQHRILVYEFMANGSLDRWLFGSDKQLDWKTRYSIALETARGLAYLHEDSRLCILHLDIKPQNILLNENFRAKVSDFGMARSMDRDIESRVVTQARGTLGYMAPEWFYEVGITSKSDVFSYGMVLLEIVSGRKNLDSSQDSEHCFFPSIAL

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
9-248 Protein kinase-like (PK-like)
Protein kinase-like domain

EHELDREYLKNLTGLPTIFTYKSIETATGRFSKEIGKGGFGKVYEGKLSDGIPVAVKCLGDWAGQGQREFCAEIATISSVNHSNLVSLRGLCVEGQHRILVYEFMANGSLDRWLFGSDKQLDWKTRYSIALETARGLAYLHEDSRLCILHLDIKPQNILLNENFRAKVSDFGMARSMDRDIESRVVTQARGTLGYMAPEWFYEVGITSKSDVFSYGMVLLEIVSGRKNLDSSQDSEHCFF

HMMPanther: PTHR24420
24-253 FAMILY NOT NAMED,FAMILY NOT NAMED

PTIFTYKSIETATGRFSKEIGKGGFGKVYEGKLSDGIPVAVKCLGDWAGQGQREFCAEIATISSVNHSNLVSLRGLCVEGQHRILVYEFMANGSLDRWLFGSDKQLDWKTRYSIALETARGLAYLHEDSRLCILHLDIKPQNILLNENFRAKVSDFGMARSMDRDIESRVVTQARGTLGYMAPEWFYEVGITSKSDVFSYGMVLLEIVSGRKNLDSSQDSEHCFFPSIAL

Gene3D: G3DSA:3.30.200.20
24-99 no description

PTIFTYKSIETATGRFSKEIGKGGFGKVYEGKLSDGIPVAVKCLGDWAGQGQREFCAEIATISSVNHSNLVSLRGL

ProfileScan: PS50011
IPR000719
37-253 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

GRFSKEIGKGGFGKVYEGKLSDGIPVAVKCLGDWAGQGQREFCAEIATISSVNHSNLVSLRGLCVEGQHRILVYEFMANGSLDRWLFGSDKQLDWKTRYSIALETARGLAYLHEDSRLCILHLDIKPQNILLNENFRAKVSDFGMARSMDRDIESRVVTQARGTLGYMAPEWFYEVGITSKSDVFSYGMVLLEIVSGRKNLDSSQDSEHCFFPSIAL

HMMSmart: SM00220
IPR002290
37-248 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

GRFSKEIGKGGFGKVYEGKLSDGIPVAVKCLGDWAGQGQREFCAEIATISSVNHSNLVSLRGLCVEGQHRILVYEFMANGSLDRWLFGSDKQLDWKTRYSIALETARGLAYLHEDSRLCILHLDIKPQNILLNENFRAKVSDFGMARSMDRDIESRVVTQARGTLGYMAPEWFYEVGITSKSDVFSYGMVLLEIVSGRKNLDSSQDSEHCFF

HMMSmart: SM00219
IPR020635
37-253 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

GRFSKEIGKGGFGKVYEGKLSDGIPVAVKCLGDWAGQGQREFCAEIATISSVNHSNLVSLRGLCVEGQHRILVYEFMANGSLDRWLFGSDKQLDWKTRYSIALETARGLAYLHEDSRLCILHLDIKPQNILLNENFRAKVSDFGMARSMDRDIESRVVTQARGTLGYMAPEWFYEVGITSKSDVFSYGMVLLEIVSGRKNLDSSQDSEHCFFPSIAL

HMMPfam: PF07714
IPR001245
39-236 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

FSKEIGKGGFGKVYEGKLSDGIPVAVKCLGDWAGQGQREFCAEIATISSVNHSNLVSLRGLCVEGQHRILVYEFMANGSLDRWLFGSDKQLDWKTRYSIALETARGLAYLHEDSRLCILHLDIKPQNILLNENFRAKVSDFGMARSMDRDIESRVVTQARGTLGYMAPEWFYEVGITSKSDVFSYGMVLLEIVSGRKN

PatternScan: PS00107
IPR017441
43-65 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGKGGFGKVYEGKLSDGIPVAVK

Gene3D: G3DSA:1.10.510.10
100-245 no description

CVEGQHRILVYEFMANGSLDRWLFGSDKQLDWKTRYSIALETARGLAYLHEDSRLCILHLDIKPQNILLNENFRAKVSDFGMARSMDRDIESRVVTQARGTLGYMAPEWFYEVGITSKSDVFSYGMVLLEIVSGRKNLDSSQDSEH

PatternScan: PS00108
IPR008271
156-168 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

ILHLDIKPQNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox