PRGDB00073564 (Pgl.3324)

From PRG Wiki
Jump to: navigation, search
Pgl.3324
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157528363 (EX329594)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Picea glauca

Comment?

GQ02830.B7_H04 GQ028 - Cambium

DNA Sequence

CTAATATCAAATTCTCTGCAGGACCGTCAGCTTCTTCCAAGGACTCCAAGGGGTATCTTTCCTCCGGATATGTTGCTCCAGAGTATATATATGCAAAGGAATTCACAGAGAAGACGGACGTGTATAGCTTTGGAGTTTTCCTGATAGAGTTGCTCACAGGAAGAAGGCCAATTGAGCCAGAGTTTGGGGAGCATGCAAGTATTGTAGACTGGGCACATGCACTTTACGGGGATTGGGATTGCAACCGCTTGATCGATCCAGTCCTCTCAGAATCTATACCTGTCTACCAAACTGAGATGATGCGTGTTATGAATCTTTCTATCCGCTGTACATCAGTTTCTCCTGCACTGCGACCCACCATGCGCGAGGTGGTGCAGATTCTTAAAACAGTTCGTAAGCCTGTGATTGGCCTTGGATGTTCTTAGTTGCTTCTCTATTTCACTAAGAAAACTAAGGTTAGAATACGATTGACCATGTATCAGATATTGGAAGGATAAATTTAATTTCTGTGATATGCATGTAATTTCATGATTTTAAGAGCCTGTGTAAAATATATAGTTAACAGGTGTATATGTAAAGAAGCTGTGGACATGCCACTAGAATTCTATTGTTCAGCGGCCCCACTCAATGGATCTAATTGATAAGAACAAGTGTTTCTATAAAAAA


Protein sequences

Name Description Sequence
Pgl.3324 translated coding region predicted by ESTScan from UniGene Pgl.3324

XNIKFSAGPSASSKDSKGYLSSGYVAPEYIYAKEFTEKTDVYSFGVFLIELLTGRRPIEPEFGEHASIVDWAHALYGDWDCNRLIDPVLSESIPVYQTEMMRVMNLSIRCTSVSPALRPTMREVVQILKTVRKPVIGLGCSXLLLYFTKKTKVRIRLTMYQILEG

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-136 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XNIKFSAGPSASSKDSKGYLSSGYVAPEYIYAKEFTEKTDVYSFGVFLIELLTGRRPIEPEFGEHASIVDWAHALYGDWDCNRLIDPVLSESIPVYQTEMMRVMNLSIRCTSVSPALRPTMREVVQILKTVRKPVI

HMMPfam: PF07714
IPR001245
12-128 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SSKDSKGYLSSGYVAPEYIYAKEFTEKTDVYSFGVFLIELLTGRRPIEPEFGEHASIVDWAHALYGDWDCNRLIDPVLSESIPVYQTEMMRVMNLSIRCTSVSPALRPTMREVVQIL

Gene3D: G3DSA:1.10.510.10
16-129 no description

SKGYLSSGYVAPEYIYAKEFTEKTDVYSFGVFLIELLTGRRPIEPEFGEHASIVDWAHALYGDWDCNRLIDPVLSESIPVYQTEMMRVMNLSIRCTSVSPALRPTMREVVQILK

superfamily: SSF56112
IPR011009
21-126 Protein kinase-like (PK-like)
Protein kinase-like domain

SSGYVAPEYIYAKEFTEKTDVYSFGVFLIELLTGRRPIEPEFGEHASIVDWAHALYGDWDCNRLIDPVLSESIPVYQTEMMRVMNLSIRCTSVSPALRPTMREVVQ

HMMPanther: PTHR24420
23-132 FAMILY NOT NAMED,FAMILY NOT NAMED

GYVAPEYIYAKEFTEKTDVYSFGVFLIELLTGRRPIEPEFGEHASIVDWAHALYGDWDCNRLIDPVLSESIPVYQTEMMRVMNLSIRCTSVSPALRPTMREVVQILKTVR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox