PRGDB00073565 (Pgl.3365)

From PRG Wiki
Jump to: navigation, search
Pgl.3365
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 49058535 (CO236220)
Gene Class Unknown
Domain Type
Gene Species Picea glauca

Comment?

WS0022.B21_J22 WS-PS-A-2 Picea glauca cDNA clone WS0022_J22 3', mRNA sequence

DNA Sequence

ttttttttttttttttttGCTGAAATAAAtgagatatttaccctgaaatatggcatttggttgatggcatttcggactgggaagcagtcgagtacaaagaatagaatactattatacatacatagaaagccttcaatggtgccgaatcaaaagaagtaacataggggggaaactgcccgatggaagaattcaaaaactccataagaggacacctaaccaaaaattatttgaagacgaacaaagtgcacttgataagtgccctgctattgaaagttgtatacagaagaaagaagaaacagacgacgaatacacattgacgaaaatctaaaaagaagcaagtcagagtcaaaccctcgagatgAGCATGATAATGCAGACTAGACCAGACATACCCGTAGTAGGAAATAAGAAAGGGGTGCCTGTGGTGGATTTGAATATTTTCGGTACGTCAGCAAGAAGTTTCTTTGTGAGAGCTGGCACTGGTGGAGCGCGGTAGTCCTCATTGTTTCTATTCATAGCCTGCAGAACAGGTTCCGGAATATTGACAGGCCCCGGAACAAATAGTTGATTTCTCCCTGGTCCATAGAAAGGATCCATCTTTTACTTTGGATCTTGAAATCCAAAAAACCGAGTGTTTGATCCTGCAACTCCTTCCCAGGGATTACCTCCCCAATCGCAATTCCAAGGAACTGGGAAGGCTGAGACCTAATTCAAAA


Protein sequences

Name Description Sequence
Pgl.3365 translated coding region predicted by ESTScan from UniGene Pgl.3365

MDPFYGPGRNQLFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTGTPFLFPTTGMSGLVCIIMLISRV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152:SF7
1-73 PTHR21152:SF7,SUBFAMILY NOT NAMED

MDPFYGPGRNQLFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTGTPFLFPTTGMSGL

HMMPanther: PTHR21152
1-73 PTHR21152,AMINOTRANSFERASE CLASS V

MDPFYGPGRNQLFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTGTPFLFPTTGMSGL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox