PRGDB00073566 (Pgl.3377)

From PRG Wiki
Jump to: navigation, search
Pgl.3377
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 211902323 (DV987591)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Picea glauca

Comment?

GQ02015.TB_J03 GQ020: Clean ROOTS systems -Diurnal cycle Picea glauca cDNA clone GQ02015_J03 3', mRNA sequence

DNA Sequence

ATCGGTGAAGCaaaaaaataaaaaaaCCAGCAGATGCTACAATCAATAAGCAGCTGCCATTGAGATGAGACACAGGTAGCTTCCCTTGGGCACTGCCCAAAAAGGTTGCCAAACATTCCAATATCCTTTCCATTATCTAAAAAAGAAAATGGGGTGAAACAGATTTAGATGGGAGAAGGAAAACACTAACATATTCTGGCAACCCGCAGATAACAGAAATAATAAAATCAAAGGAGCAATTCTGCAACGTGACAAAATCCAACTGAAGTCACAAAGAAAAAATGGTTCTAATCAAGCTTTGGCATTGTGGCAATCCCTGGTTCTAATTAATCTTTATCACTGACCCAGTCTCTAACTAAGGAATTTCTGCAGAACTGGATAGATCCTCAGTGCCATCATCATCTTCAATATTTCGCCTCAAGTCTTCGATCCTTTTGACTACTTCCTTCATGCTGGGTCTTTGATCTGGATATTGTGCAACACAATCGATTGCAACCTGCAATAACTGAACCATATCTTCTTCAAAGTTATGGTGTCTTAGGAGCTCTATGTCAAACACTTCTGCAGTCCATTCCTCACGAACAATGGACTGCACCCAGCGTGGAAGATCAACTCCGTCATCATTGGCAGATCCATGAGAAGGTGCTTTGCCAGTCAGAATCTCCAAAAGCAATACACCAAAGCTGTAAACATCAGCCTTCTGTGAAATTTTGCGGGCATCGGTGACTTCTGGAGCTCTATATCCGACAATTCTATTGGCAGATGGAGTTGCACTCACTAACTGAGCAAGCCCAAAATCTGAAACACCGGCATTGTAGTCCCTTGTGAGAAGAATGTTGGAAGACTTGATGTTTCCATGAGAAATTTCTCTTCCTCTACTATGTATATACTCGATGCCTCTAGCTGCACCAAGAGCAATACGAGAGCGTGTTTCCCAGTCCAACGGAGTTCGACCTGCGCCCC


Protein sequences

Name Description Sequence
Pgl.3377 translated coding region predicted by ESTScan from UniGene Pgl.3377

XGAGRTPLDWETRSRIALGAARGIEYIHSRGREISHGNIKSSNILLTRDYNAGVSDFGLAQLVSATPSANRIVGYRAPEVTDARKISQKADVYSFGVLLLEILTGKAPSHGSANDDGVDLPRWVQSIVREEWTAEVFDIELLRHHNFEEDMVQLLQVAIDCVAQYPDQRPSMKEVVKRIEDLRRNIEDDDGTEDLSSSAEIP

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-182 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XGAGRTPLDWETRSRIALGAARGIEYIHSRGREISHGNIKSSNILLTRDYNAGVSDFGLAQLVSATPSANRIVGYRAPEVTDARKISQKADVYSFGVLLLEILTGKAPSHGSANDDGVDLPRWVQSIVREEWTAEVFDIELLRHHNFEEDMVQLLQVAIDCVAQYPDQRPSMKEVVKRIEDL

HMMSmart: SM00219
IPR020635
2-179 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

GAGRTPLDWETRSRIALGAARGIEYIHSRGREISHGNIKSSNILLTRDYNAGVSDFGLAQLVSATPSANRIVGYRAPEVTDARKISQKADVYSFGVLLLEILTGKAPSHGSANDDGVDLPRWVQSIVREEWTAEVFDIELLRHHNFEEDMVQLLQVAIDCVAQYPDQRPSMKEVVKRI

HMMSmart: SM00220
IPR002290
3-179 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

AGRTPLDWETRSRIALGAARGIEYIHSRGREISHGNIKSSNILLTRDYNAGVSDFGLAQLVSATPSANRIVGYRAPEVTDARKISQKADVYSFGVLLLEILTGKAPSHGSANDDGVDLPRWVQSIVREEWTAEVFDIELLRHHNFEEDMVQLLQVAIDCVAQYPDQRPSMKEVVKRI

HMMPanther: PTHR24420:SF543
4-188 OS03G0223000 PROTEIN (FRAGMENT)

GRTPLDWETRSRIALGAARGIEYIHSRGREISHGNIKSSNILLTRDYNAGVSDFGLAQLVSATPSANRIVGYRAPEVTDARKISQKADVYSFGVLLLEILTGKAPSHGSANDDGVDLPRWVQSIVREEWTAEVFDIELLRHHNFEEDMVQLLQVAIDCVAQYPDQRPSMKEVVKRIEDLRRNIED

HMMPanther: PTHR24420
4-188 FAMILY NOT NAMED,FAMILY NOT NAMED

GRTPLDWETRSRIALGAARGIEYIHSRGREISHGNIKSSNILLTRDYNAGVSDFGLAQLVSATPSANRIVGYRAPEVTDARKISQKADVYSFGVLLLEILTGKAPSHGSANDDGVDLPRWVQSIVREEWTAEVFDIELLRHHNFEEDMVQLLQVAIDCVAQYPDQRPSMKEVVKRIEDLRRNIED

HMMPfam: PF00069
IPR017442
6-178 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

TPLDWETRSRIALGAARGIEYIHSRGREISHGNIKSSNILLTRDYNAGVSDFGLAQLVSATPSANRIVGYRAPEVTDARKISQKADVYSFGVLLLEILTGKAPSHGSANDDGVDLPRWVQSIVREEWTAEVFDIELLRHHNFEEDMVQLLQVAIDCVAQYPDQRPSMKEVVKR

Gene3D: G3DSA:1.10.510.10
7-184 no description

PLDWETRSRIALGAARGIEYIHSRGREISHGNIKSSNILLTRDYNAGVSDFGLAQLVSATPSANRIVGYRAPEVTDARKISQKADVYSFGVLLLEILTGKAPSHGSANDDGVDLPRWVQSIVREEWTAEVFDIELLRHHNFEEDMVQLLQVAIDCVAQYPDQRPSMKEVVKRIEDLRR

superfamily: SSF56112
IPR011009
7-187 Protein kinase-like (PK-like)
Protein kinase-like domain

PLDWETRSRIALGAARGIEYIHSRGREISHGNIKSSNILLTRDYNAGVSDFGLAQLVSATPSANRIVGYRAPEVTDARKISQKADVYSFGVLLLEILTGKAPSHGSANDDGVDLPRWVQSIVREEWTAEVFDIELLRHHNFEEDMVQLLQVAIDCVAQYPDQRPSMKEVVKRIEDLRRNIE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox