PRGDB00073735 (Pgl.16227)

From PRG Wiki
Jump to: navigation, search
Pgl.16227
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157567492 (EX368720)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Picea glauca

Comment?

GQ03214.B7_N04 GQ032 - Shoot tip (Normalized library) Picea glauca cDNA clone GQ03214_N04 5', mRNA sequence

DNA Sequence

CATTGAAAGCTCAGAAAGGCTACTGGTTTACGAATACCTCCAGAACAGTAGTCTGGACAAGATTCTATTCGGTTCCTTCTAGTCCATTACCTGCATAATCACTGCACGTATCCTGGATTCGTTCGAGTTTGAATATGTGGGTTTCTAATATTTTTCCTATGTGATGCTTTGCAGATGCAACAGAACATCATTTACTTGGCTGGAAAGAGAGGTATGAAATCATGGTTGGAACTGCGCGTGGGCTAGCCTATCTTCACGAGGACTTTCGGATCATCCACAGAGATATTAAAACAAGCAATATTTTACTGGATGGTAAATATAGACCAAAAATAGCAGACTTTGGGTTAGCCAGATTCTTCGCGGAAGATCAGAGCCACGTGACCACTAGCGTTGCAGGAACTTTAGGTTACATGGCCCCGGAGTACGCCTTACACGGACAGCTGACAGAGAAAGTAGATGTATTTGGCTTTGGTGTACTTGTACTTGAGGTTATCAGCGGAAGAAAGAGTCAGAGTTTGGTTCATGACACGGAGTTTCTCATCCAAAGAACATGGAGACTGTATAAAGCAGAGAGAGCTTTAGAAGTTATCGATCCCAGGTGGTGTCGATGCTCACAAGTGAACGAGAAAATCTTCCTTCGCCCACGAAACCTCCTTTCGTAGAACTGGATAGTGTGGTGGGGTTGTATGACCAAGTAAAGCGTCCTAGAATTAATGCAACTCCTCCTCAAGACCCGAACAAAACATCAAGCAGTGCAGCAACTTCTTCAACGAGACCTTCCGATATCCAATCTGGAGCTCCTTCCCCTTCATCAAGCTATCGGGAGCCTGGATGACCATCT


Protein sequences

Name Description Sequence
Pgl.16227 translated coding region predicted by ESTScan from UniGene Pgl.16227

MVGTARGLAYLHEDFRIIHRDIKTSNILLDGKYRPKIADFGLARFFAEDQSHVTTSVAGTLGYMAPEYALHGQLTEKVDVFGFGVLVLEVISGRKSQSLVHDTEFLIQRTWRLYKAERALEVIDPQVVSMLTSERENLPSPTKPPFVELDSVVGLYDQVKRPRINATPPQDPNKTSSSAATSSTRPSDIQSGAPSPSSSYREPGXPS

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-147 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

MVGTARGLAYLHEDFRIIHRDIKTSNILLDGKYRPKIADFGLARFFAEDQSHVTTSVAGTLGYMAPEYALHGQLTEKVDVFGFGVLVLEVISGRKSQSLVHDTEFLIQRTWRLYKAERALEVIDPQVVSMLTSERENLPSPTKPPFV

superfamily: SSF56112
IPR011009
1-163 Protein kinase-like (PK-like)
Protein kinase-like domain

MVGTARGLAYLHEDFRIIHRDIKTSNILLDGKYRPKIADFGLARFFAEDQSHVTTSVAGTLGYMAPEYALHGQLTEKVDVFGFGVLVLEVISGRKSQSLVHDTEFLIQRTWRLYKAERALEVIDPQVVSMLTSERENLPSPTKPPFVELDSVVGLYDQVKRPR

HMMSmart: SM00220
IPR002290
1-147 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

MVGTARGLAYLHEDFRIIHRDIKTSNILLDGKYRPKIADFGLARFFAEDQSHVTTSVAGTLGYMAPEYALHGQLTEKVDVFGFGVLVLEVISGRKSQSLVHDTEFLIQRTWRLYKAERALEVIDPQVVSMLTSERENLPSPTKPPFV

HMMPanther: PTHR24420
2-127 FAMILY NOT NAMED,FAMILY NOT NAMED

VGTARGLAYLHEDFRIIHRDIKTSNILLDGKYRPKIADFGLARFFAEDQSHVTTSVAGTLGYMAPEYALHGQLTEKVDVFGFGVLVLEVISGRKSQSLVHDTEFLIQRTWRLYKAERALEVIDPQV

Gene3D: G3DSA:1.10.510.10
3-96 no description

GTARGLAYLHEDFRIIHRDIKTSNILLDGKYRPKIADFGLARFFAEDQSHVTTSVAGTLGYMAPEYALHGQLTEKVDVFGFGVLVLEVISGRKS

HMMPfam: PF00069
IPR017442
4-96 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

TARGLAYLHEDFRIIHRDIKTSNILLDGKYRPKIADFGLARFFAEDQSHVTTSVAGTLGYMAPEYALHGQLTEKVDVFGFGVLVLEVISGRKS

PatternScan: PS00108
IPR008271
17-29 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKTSNILL

Seg: seg
175-184 seg

TSSSAATSST






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox