PRGDB00073747 (Pgl.17372)

From PRG Wiki
Jump to: navigation, search
Pgl.17372
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157566785 (EX368013)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Picea glauca

Comment?

GQ03213.B7_O02 GQ032 - Shoot tip (Normalized library) Picea glauca cDNA clone GQ03213_O02 5', mRNA sequence

DNA Sequence

AAGAGAGATTACTTTGTTATCGCGTGTGCAACATAAGAATTTAGTGAAGTTTATTGGAGCCTGCAAAGAGTCGATGATGGTGGTGGTCACTGAACTTCTATTAGGTGGATCGCTGCGGAAATACATGATGAGTTTACGGCCAAAGCACTTAGATATGCGTGTTGCTCTTAGTTTTGCACTGGACATAGCCCAAGTTATGGAGTGTTTACATGGAAATGGAATTATTCACCGTGACCTTAAGCCTGATAACCTTCTCTTGACTGCTGATCAAAAGAAAGTTAAGCTAGCAGATTTTGGATTGGCGAGAGAGGAGACGTTAACTGAAATGATGACTGCAGAAACCGGCACTTACCGATGGATGGCTCCTGAGTTGTACAGTACTGTAACACTAAGACGGGGAGAGAAAAAACATTATGATAACAAGGTAGACGTGTACAGTTTTTCAATAGTTTTGTGGGAGCTACTGACCAACCGTATGCCATTTGAAGGCATGTCCAATCTACAAGCAGCATATGCTGCTGCTTTCAAGAGTGTAAGGCCAAGTGTAGAGAATCTTCCAGAAGAATTGGTTTTCATTTTACAGTGCTGCTGGGCTGAGGATCCAAATCTCCGCCCTAACTTCACTCAGATAGTACGGATGCTTAGCACCTTTCTTATATCTCTTCCAGCTCCTGAAAATACACCACCACCACAAATTGTTGCCTCCAAAACTAGCAGCCCTCCAACGGAATCTCCCGGCACAAGTTCTTTGGAGGAGAAGAGTCAACAAAATATAAATGCGAAGTTAGAAAACTCATCCCGACGACTGCTGCTATGTTTTGGCAATTGCATAGGAGCTTGAAATGGCCTTTATCTGGAGAAAATACTCTGCATCGAATTTATTAACAAATCTACGTAACGGTAGCACTACAAAGCTATAGGT


Protein sequences

Name Description Sequence
Pgl.17372 translated coding region predicted by ESTScan from UniGene Pgl.17372

XREITLLSRVQHKNLVKFIGACKESMMVVVTELLLGGSLRKYMMSLRPKHLDMRVALSFALDIAQVMECLHGNGIIHRDLKPDNLLLTADQKKVKLADFGLAREETLTEMMTAETGTYRWMAPELYSTVTLRRGEKKHYDNKVDVYSFSIVLWELLTNRMPFEGMSNLQAAYAAAFKSVRPSVENLPEELVFILQCCWAEDPNLRPNFTQIVRMLSTFLISLPAPENTPPPQIVASKTSSPPTESPGTSSLEEKSQQNINAKLENSSRRLLLCFGNCIGA

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-219 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XREITLLSRVQHKNLVKFIGACKESMMVVVTELLLGGSLRKYMMSLRPKHLDMRVALSFALDIAQVMECLHGNGIIHRDLKPDNLLLTADQKKVKLADFGLAREETLTEMMTAETGTYRWMAPELYSTVTLRRGEKKHYDNKVDVYSFSIVLWELLTNRMPFEGMSNLQAAYAAAFKSVRPSVENLPEELVFILQCCWAEDPNLRPNFTQIVRMLSTFL

HMMSmart: SM00219
IPR020635
1-215 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

XREITLLSRVQHKNLVKFIGACKESMMVVVTELLLGGSLRKYMMSLRPKHLDMRVALSFALDIAQVMECLHGNGIIHRDLKPDNLLLTADQKKVKLADFGLAREETLTEMMTAETGTYRWMAPELYSTVTLRRGEKKHYDNKVDVYSFSIVLWELLTNRMPFEGMSNLQAAYAAAFKSVRPSVENLPEELVFILQCCWAEDPNLRPNFTQIVRML

HMMSmart: SM00220
IPR002290
1-219 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

XREITLLSRVQHKNLVKFIGACKESMMVVVTELLLGGSLRKYMMSLRPKHLDMRVALSFALDIAQVMECLHGNGIIHRDLKPDNLLLTADQKKVKLADFGLAREETLTEMMTAETGTYRWMAPELYSTVTLRRGEKKHYDNKVDVYSFSIVLWELLTNRMPFEGMSNLQAAYAAAFKSVRPSVENLPEELVFILQCCWAEDPNLRPNFTQIVRMLSTFL

superfamily: SSF56112
IPR011009
2-275 Protein kinase-like (PK-like)
Protein kinase-like domain

REITLLSRVQHKNLVKFIGACKESMMVVVTELLLGGSLRKYMMSLRPKHLDMRVALSFALDIAQVMECLHGNGIIHRDLKPDNLLLTADQKKVKLADFGLAREETLTEMMTAETGTYRWMAPELYSTVTLRRGEKKHYDNKVDVYSFSIVLWELLTNRMPFEGMSNLQAAYAAAFKSVRPSVENLPEELVFILQCCWAEDPNLRPNFTQIVRMLSTFLISLPAPENTPPPQIVASKTSSPPTESPGTSSLEEKSQQNINAKLENSSRRLLLCFG

HMMPanther: PTHR23257:SF83
IPR015784
2-251 PROTEIN KINASE ATN1
Serine/threonine-protein kinase, ATN1-like

REITLLSRVQHKNLVKFIGACKESMMVVVTELLLGGSLRKYMMSLRPKHLDMRVALSFALDIAQVMECLHGNGIIHRDLKPDNLLLTADQKKVKLADFGLAREETLTEMMTAETGTYRWMAPELYSTVTLRRGEKKHYDNKVDVYSFSIVLWELLTNRMPFEGMSNLQAAYAAAFKSVRPSVENLPEELVFILQCCWAEDPNLRPNFTQIVRMLSTFLISLPAPENTPPPQIVASKTSSPPTESPGTSSL

HMMPanther: PTHR23257
2-251 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

REITLLSRVQHKNLVKFIGACKESMMVVVTELLLGGSLRKYMMSLRPKHLDMRVALSFALDIAQVMECLHGNGIIHRDLKPDNLLLTADQKKVKLADFGLAREETLTEMMTAETGTYRWMAPELYSTVTLRRGEKKHYDNKVDVYSFSIVLWELLTNRMPFEGMSNLQAAYAAAFKSVRPSVENLPEELVFILQCCWAEDPNLRPNFTQIVRMLSTFLISLPAPENTPPPQIVASKTSSPPTESPGTSSL

Gene3D: G3DSA:3.30.200.20
2-50 no description

REITLLSRVQHKNLVKFIGACKESMMVVVTELLLGGSLRKYMMSLRPKH

HMMPfam: PF07714
IPR001245
2-215 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

REITLLSRVQHKNLVKFIGACKESMMVVVTELLLGGSLRKYMMSLRPKHLDMRVALSFALDIAQVMECLHGNGIIHRDLKPDNLLLTADQKKVKLADFGLAREETLTEMMTAETGTYRWMAPELYSTVTLRRGEKKHYDNKVDVYSFSIVLWELLTNRMPFEGMSNLQAAYAAAFKSVRPSVENLPEELVFILQCCWAEDPNLRPNFTQIVRML

FPrintScan: PR00109
IPR001245
31-44 TYRKINASE
Serine-threonine/tyrosine-protein kinase

TELLLGGSLRKYMM

Gene3D: G3DSA:1.10.510.10
51-261 no description

LDMRVALSFALDIAQVMECLHGNGIIHRDLKPDNLLLTADQKKVKLADFGLAREETLTEMMTAETGTYRWMAPELYSTVTLRRGEKKHYDNKVDVYSFSIVLWELLTNRMPFEGMSNLQAAYAAAFKSVRPSVENLPEELVFILQCCWAEDPNLRPNFTQIVRMLSTFLISLPAPENTPPPQIVASKTSSPPTESPGTSSLEEKSQQNINA

FPrintScan: PR00109
IPR001245
69-87 TYRKINASE
Serine-threonine/tyrosine-protein kinase

CLHGNGIIHRDLKPDNLLL

PatternScan: PS00108
IPR008271
75-87 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKPDNLLL

Seg: seg
101-115 seg

LAREETLTEMMTAET

FPrintScan: PR00109
IPR001245
143-165 TYRKINASE
Serine-threonine/tyrosine-protein kinase

VDVYSFSIVLWELLTNRMPFEGM

FPrintScan: PR00109
IPR001245
186-208 TYRKINASE
Serine-threonine/tyrosine-protein kinase

LPEELVFILQCCWAEDPNLRPNF

Seg: seg
236-253 seg

SKTSSPPTESPGTSSLEE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox