PRGDB00073817 (Pgl.22374)

From PRG Wiki
Jump to: navigation, search
Pgl.22374
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157565066 (EX366294)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Picea glauca

Comment?

GQ03211.B7_D04 GQ032 - Shoot tip (Normalized library) Picea glauca cDNA clone GQ03211_D04 5', mRNA sequence

DNA Sequence

CCCTGCTGCTGCAGCATCCTCCCCTGCATAGTCCTTCCCCTACTCGACATATAATCATCGAGTAACCATTCCCTCTGCTCCCGTTTTGGGCACATACACGGCAAGAATCCATCCATCTGCTCGGTTTGCAATTTGGGATTTTCGATTATTTGTTTCTGATTCGGGGGGATGGCCACCAGGGTGAATCCGCCTTGCGGAGTTTTTGCAGAGGGGAAGCACTACTATTCCATGTGGCGCAACACGTTCGAGATAGACACCAAGTATATTCCCATCAAACCTATTGGGAAGGGCGCCTATGGAATTGTTTGCTCGGCCAAAAACGCAGAGACCAACGAGAAAGTGGCCATTAAGAAGATCATCAACGCATTCGAGAACCAGACCGATGCGAGGAGGACGCTCAGGGAAATCAAGCTTCTCAGGCTGTTCGCCCATGATAATATAATTGCCTTGAAGGACATCATGACCCCTGCTTGTAGGACTAATTTCAACGATGTTTATCTGGTCTATGATCTTATGGACACCGACCTACACCAGATCATCAAGTCTGCTCAGGTCCTAACCGATGATCACTGCAAGTACTTCATCTATCAGTTGCTGCGAGGACTAAAGTATCTGCATTCTGCCAATGTGTTGCATAGAGATTTGAAGCCAAGCAATCTATTATTGAATGCTAATTGTGACCTTAAGATATGTGATTTTGGTCTAGCTCGAACAAACTGTGAGAAAGGACAGTTCATGACTGAATATGTTGTCACTCGATGGTATAGGGCTCCTGAATTGCTTCTGTCCTGTGAGGAGTATGGTACATCGATCGATATTTGGTCTGTAGGCTGTATATTTGCAGAGTTGTTGGGACGAAAGCCCATATTCCCTGGTAAGGATTATATTAATCAAC


Protein sequences

Name Description Sequence
Pgl.22374 translated coding region predicted by ESTScan from UniGene Pgl.22374

MATRVNPPCGVFAEGKHYYSMWRNTFEIDTKYIPIKPIGKGAYGIVCSAKNAETNEKVAIKKIINAFENQTDARRTLREIKLLRLFAHDNIIALKDIMTPACRTNFNDVYLVYDLMDTDLHQIIKSAQVLTDDHCKYFIYQLLRGLKYLHSANVLHRDLKPSNLLLNANCDLKICDFGLARTNCEKGQFMTEYVVTRWYRAPELLLSCEEYGTSIDIWSVGCIFAELLGRKPIFPGKDYINQX

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
18-242 Protein kinase-like (PK-like)
Protein kinase-like domain

YYSMWRNTFEIDTKYIPIKPIGKGAYGIVCSAKNAETNEKVAIKKIINAFENQTDARRTLREIKLLRLFAHDNIIALKDIMTPACRTNFNDVYLVYDLMDTDLHQIIKSAQVLTDDHCKYFIYQLLRGLKYLHSANVLHRDLKPSNLLLNANCDLKICDFGLARTNCEKGQFMTEYVVTRWYRAPELLLSCEEYGTSIDIWSVGCIFAELLGRKPIFPGKDYINQ

HMMPanther: PTHR24055
18-242 FAMILY NOT NAMED,MITOGEN-ACTIVATED PROTEIN KINASE

YYSMWRNTFEIDTKYIPIKPIGKGAYGIVCSAKNAETNEKVAIKKIINAFENQTDARRTLREIKLLRLFAHDNIIALKDIMTPACRTNFNDVYLVYDLMDTDLHQIIKSAQVLTDDHCKYFIYQLLRGLKYLHSANVLHRDLKPSNLLLNANCDLKICDFGLARTNCEKGQFMTEYVVTRWYRAPELLLSCEEYGTSIDIWSVGCIFAELLGRKPIFPGKDYINQ

Gene3D: G3DSA:3.30.200.20
19-133 no description

YSMWRNTFEIDTKYIPIKPIGKGAYGIVCSAKNAETNEKVAIKKIINAFENQTDARRTLREIKLLRLFAHDNIIALKDIMTPACRTNFNDVYLVYDLMDTDLHQIIKSAQVLTDD

ProfileScan: PS50011
IPR000719
32-243 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YIPIKPIGKGAYGIVCSAKNAETNEKVAIKKIINAFENQTDARRTLREIKLLRLFAHDNIIALKDIMTPACRTNFNDVYLVYDLMDTDLHQIIKSAQVLTDDHCKYFIYQLLRGLKYLHSANVLHRDLKPSNLLLNANCDLKICDFGLARTNCEKGQFMTEYVVTRWYRAPELLLSCEEYGTSIDIWSVGCIFAELLGRKPIFPGKDYINQX

HMMSmart: SM00220
IPR002290
32-240 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YIPIKPIGKGAYGIVCSAKNAETNEKVAIKKIINAFENQTDARRTLREIKLLRLFAHDNIIALKDIMTPACRTNFNDVYLVYDLMDTDLHQIIKSAQVLTDDHCKYFIYQLLRGLKYLHSANVLHRDLKPSNLLLNANCDLKICDFGLARTNCEKGQFMTEYVVTRWYRAPELLLSCEEYGTSIDIWSVGCIFAELLGRKPIFPGKDYI

HMMSmart: SM00219
IPR020635
32-240 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YIPIKPIGKGAYGIVCSAKNAETNEKVAIKKIINAFENQTDARRTLREIKLLRLFAHDNIIALKDIMTPACRTNFNDVYLVYDLMDTDLHQIIKSAQVLTDDHCKYFIYQLLRGLKYLHSANVLHRDLKPSNLLLNANCDLKICDFGLARTNCEKGQFMTEYVVTRWYRAPELLLSCEEYGTSIDIWSVGCIFAELLGRKPIFPGKDYI

HMMPfam: PF00069
IPR017442
35-242 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

IKPIGKGAYGIVCSAKNAETNEKVAIKKIINAFENQTDARRTLREIKLLRLFAHDNIIALKDIMTPACRTNFNDVYLVYDLMDTDLHQIIKSAQVLTDDHCKYFIYQLLRGLKYLHSANVLHRDLKPSNLLLNANCDLKICDFGLARTNCEKGQFMTEYVVTRWYRAPELLLSCEEYGTSIDIWSVGCIFAELLGRKPIFPGKDYINQ

PatternScan: PS00107
IPR017441
38-62 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGKGAYGIVCSAKNAETNEKVAIKK

PatternScan: PS01351
IPR003527
67-170 MAPK
MAP kinase, conserved site

FENQTDARRTLREIKLLRLFAHDNIIALKDIMTPACRTNFNDVYLVYDLMDTDLHQIIKSAQVLTDDHCKYFIYQLLRGLKYLHSANVLHRDLKPSNLLLNANC

Gene3D: G3DSA:1.10.510.10
134-240 no description

HCKYFIYQLLRGLKYLHSANVLHRDLKPSNLLLNANCDLKICDFGLARTNCEKGQFMTEYVVTRWYRAPELLLSCEEYGTSIDIWSVGCIFAELLGRKPIFPGKDYI

PatternScan: PS00108
IPR008271
154-166 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLHRDLKPSNLLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox