PRGDB00073845 (Pgl.22664)

From PRG Wiki
Jump to: navigation, search
Pgl.22664
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 211604967 (GE480344)
Gene Class Unknown
Domain Type LRR
Gene Species Picea glauca

Comment?

GQ02012.B3.r_L13 GQ020: Clean ROOTS systems -Diurnal cycle Picea glauca cDNA clone GQ02012_L13 5', mRNA sequence

DNA Sequence

GTTTTTAAGTGGAAATCCATATTTGACAAAAATCCCAACAAGGCTGAACAAGAGTATGATCTCCCTCAAGGCTTTCTCTTTAAGTGGAACGTCAGTGAAATCATTGCCAAAGGATATGGGGTGTTTGGAGCAGCTAATATATTTGGGTTTAAGATGCATGCCCATCAATAGATTACCTGCATCTTTTACCAATCTTGTAAATCTGGAGGTCCTTGATCTTTCCTATTCTGCCATCAAAGAATTACCATCCTCAATTCATATGCTGAGATCTTTAAGAAAACTAAGTCTAGAGGGATGTAAGGATTTGCAATATCTACCTAGGAGTATCTCAGGGCTTACATCTTTGGAGCATTTAGAAACTTTTGGTTGTACATCTCTTTGGAACAAGCATAAGTGTACAGGATGGAGGAAAACAACTTTTATTCACAATTTGGCCAGTTTAACACAACTTAAAAGATTGCAGCTACAGAATAATGGGGAGATTATTAGTGACGGGACATTAGGGAAGATGACTCAAATGAACTCCCTCACATTGTCACTCACAAAGATGGAAAATCTACCCAATGACATAAGTAATATGTCAAAATTGAGGAGGTTAGCATTATTAGAATGCTTTCACTTGGTTAAATTGGATCATAAATTTTATGATTTTCAATATTTGGGTTATCTTAAATTTGCTGGTTGTCATTTCTTGGAAGAACTTCCACATTTACATCAACTTAAGAGCTTGAGGCAATTAGAGATCATTGATTGTCCTAGAATAAGGAAGTTTCCCAAAGAATTCGGTTACAAAGGGGCATTTCCTTTGTTGGAGATATTTTCACTTGCTTGGCTACCTATGTTAGAGGAGTTGCTAGTGATAGAGGAAGGGTGCATGACTTCACTTCAAA


Protein sequences

Name Description Sequence
Pgl.22664 translated coding region predicted by ESTScan from UniGene Pgl.22664

XFLSGNPYLTKIPTRLNKSMISLKAFSLSGTSVKSLPKDMGCLEQLIYLGLRCMPINRLPASFTNLVNLEVLDLSYSAIKELPSSIHMLRSLRKLSLEGCKDLQYLPRSISGLTSLEHLETFGCTSLWNKHKCTGWRKTTFIHNLASLTQLKRLQLQNNGEIISDGTLGKMTQMNSLTLSLTKMENLPNDISNMSKLRRLALLECFHLVKLDHKFYDFQYLGYLKFAGCHFLEELPHLHQLKSLRQLEIIDCPRIRKFPKEFGYKGAFPLLEIFSLAWLPMLEELLVIEEGCMTSLQX


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
3-278 L domain-like,LRR

LSGNPYLTKIPTRLNKSMISLKAFSLSGTSVKSLPKDMGCLEQLIYLGLRCMPINRLPASFTNLVNLEVLDLSYSAIKELPSSIHMLRSLRKLSLEGCKDLQYLPRSISGLTSLEHLETFGCTSLWNKHKCTGWRKTTFIHNLASLTQLKRLQLQNNGEIISDGTLGKMTQMNSLTLSLTKMENLPNDISNMSKLRRLALLECFHLVKLDHKFYDFQYLGYLKFAGCHFLEELPHLHQLKSLRQLEIIDCPRIRKFPKEFGYKGAFPLLEIFSLAW

Gene3D: G3DSA:3.80.10.10
4-119 no description

SGNPYLTKIPTRLNKSMISLKAFSLSGTSVKSLPKDMGCLEQLIYLGLRCMPINRLPASFTNLVNLEVLDLSYSAIKELPSSIHMLRSLRKLSLEGCKDLQYLPRSISGLTSLEHL

HMMPanther: PTHR23155:SF121
9-297 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LTKIPTRLNKSMISLKAFSLSGTSVKSLPKDMGCLEQLIYLGLRCMPINRLPASFTNLVNLEVLDLSYSAIKELPSSIHMLRSLRKLSLEGCKDLQYLPRSISGLTSLEHLETFGCTSLWNKHKCTGWRKTTFIHNLASLTQLKRLQLQNNGEIISDGTLGKMTQMNSLTLSLTKMENLPNDISNMSKLRRLALLECFHLVKLDHKFYDFQYLGYLKFAGCHFLEELPHLHQLKSLRQLEIIDCPRIRKFPKEFGYKGAFPLLEIFSLAWLPMLEELLVIEEGCMTSLQ

HMMPanther: PTHR23155
9-297 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LTKIPTRLNKSMISLKAFSLSGTSVKSLPKDMGCLEQLIYLGLRCMPINRLPASFTNLVNLEVLDLSYSAIKELPSSIHMLRSLRKLSLEGCKDLQYLPRSISGLTSLEHLETFGCTSLWNKHKCTGWRKTTFIHNLASLTQLKRLQLQNNGEIISDGTLGKMTQMNSLTLSLTKMENLPNDISNMSKLRRLALLECFHLVKLDHKFYDFQYLGYLKFAGCHFLEELPHLHQLKSLRQLEIIDCPRIRKFPKEFGYKGAFPLLEIFSLAWLPMLEELLVIEEGCMTSLQ

ProfileScan: PS51450
IPR001611
22-43 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKAFSLSGTSVKSLPKDMGCL

HMMPfam: PF13855
45-101 LRR_8,Leucine rich repeat

QLIYLGLRCMPINRLPASFTNLVNLEVLDLSYSAIKELPSSIHMLRSLRKLSLEGCK

ProfileScan: PS51450
IPR001611
68-89 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEVLDLSYSAIKELPSSIHML

Gene3D: G3DSA:3.80.10.10
141-289 no description

FIHNLASLTQLKRLQLQNNGEIISDGTLGKMTQMNSLTLSLTKMENLPNDISNMSKLRRLALLECFHLVKLDHKFYDFQYLGYLKFAGCHFLEELPHLHQLKSLRQLEIIDCPRIRKFPKEFGYKGAFPLLEIFSLAWLPMLEELLVIE

ProfileScan: PS51450
IPR001611
150-172 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLKRLQLQNNGEIISDGTLGKMT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox