PRGDB00073847 (Pgl.22727)

From PRG Wiki
Jump to: navigation, search
Pgl.22727
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 211603756 (GE480790)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Picea glauca

Comment?

GQ02016.B3.r_O18 GQ020: Clean ROOTS systems -Diurnal cycle Picea glauca cDNA clone GQ02016_O18 5', mRNA sequence

DNA Sequence

GTCCATACTGAACGATATGTGCTTTGTCTCCAATTATTCTAGCTCGCGGTTGGAAAACTGGCGGTTTTTTGACCCTCCCGACGCGAGGGATTGAGTTTTTAAAACATCAAAACAAGGACGGGCAGTGAAAGGAGCTCTCGTGTTCAATCTCTTTCCAAGATCAGTTGGTTTACTAAAATGACTCACCACGGCGGGCCTATGCGTACACGACTCGGAAAGTATGAGCTCGGTAGGGTTATAGGAGAGGGCTCGTTTGCCAAAGTTCGACTCGCTAAAAACGTGGAGACGGGACAGAATTTTGCCATCAAAGTGCTCAACAAAGAGAGAATATTAAAGGATAAGATGGTGGAGCAGATAAAGAGAGAGATCTCTACAATGAAACTGGTAAAGCATCCTAATATTGTACAGCTTTTCGAGGTTATGGCTAGCAAGACAAAGATATATTTTGTTCTTGAGTACGTTACAGGAGGAGAGCTTTTTAATCAAATTGCCCAACATGGGAAATTGAAGGAAGACGATGCTAGAAAATATTTTCAGCAACTTGTAAATGCAGTTGATTATTGTCATAGCAGAGGAGTTTACCATAGAGATCTCAAGCCGGAGAACCTTCTTTTGGATTCAAAAGGAAATCTGAAGATCTCAGATTTTGGTCTTAGTGCACTTTCACAGCAAGTGAAGGAAGATGGACTGTTGCATACTACATGTGGAACCCCCAACTATGTTGCCCCGGAGGTCATTGTGGACAAGGGATATGATGGTGCTAAAGCTGATCTGTGGTCTTGTGGAGTCATTCTCTTTGTCCTCATGGCAGGCTTTTTACCATTTGATGAACCCAACATCATAGCCCTTTATAAGAAGATATACAGAGCAGATTTCACCTGTCCGAAGTGGTTTTCTCCAGGAGCTCGGAAACTATTTCTGAGAATACTTGAGCCAAAATTTAAATATCGGATT


Protein sequences

Name Description Sequence
Pgl.22727 translated coding region predicted by ESTScan from UniGene Pgl.22727

MTHHGGPMRTRLGKYELGRVIGEGSFAKVRLAKNVETGQNFAIKVLNKERILKDKMVEQIKREISTMKLVKHPNIVQLFEVMASKTKIYFVLEYVTGGELFNQIAQHGKLKEDDARKYFQQLVNAVDYCHSRGVYHRDLKPENLLLDSKGNLKISDFGLSALSQQVKEDGLLHTTCGTPNYVAPEVIVDKGYDGAKADLWSCGVILFVLMAGFLPFDEPNIIALYKKIYRADFTCPKWFSPGARKLFLRILEPKFKYRI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24345:SF45
9-259 SUBFAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE PLK1

RTRLGKYELGRVIGEGSFAKVRLAKNVETGQNFAIKVLNKERILKDKMVEQIKREISTMKLVKHPNIVQLFEVMASKTKIYFVLEYVTGGELFNQIAQHGKLKEDDARKYFQQLVNAVDYCHSRGVYHRDLKPENLLLDSKGNLKISDFGLSALSQQVKEDGLLHTTCGTPNYVAPEVIVDKGYDGAKADLWSCGVILFVLMAGFLPFDEPNIIALYKKIYRADFTCPKWFSPGARKLFLRILEPKFKYRI

HMMPanther: PTHR24345
9-259 FAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE PLK

RTRLGKYELGRVIGEGSFAKVRLAKNVETGQNFAIKVLNKERILKDKMVEQIKREISTMKLVKHPNIVQLFEVMASKTKIYFVLEYVTGGELFNQIAQHGKLKEDDARKYFQQLVNAVDYCHSRGVYHRDLKPENLLLDSKGNLKISDFGLSALSQQVKEDGLLHTTCGTPNYVAPEVIVDKGYDGAKADLWSCGVILFVLMAGFLPFDEPNIIALYKKIYRADFTCPKWFSPGARKLFLRILEPKFKYRI

Gene3D: G3DSA:3.30.200.20
10-114 no description

TRLGKYELGRVIGEGSFAKVRLAKNVETGQNFAIKVLNKERILKDKMVEQIKREISTMKLVKHPNIVQLFEVMASKTKIYFVLEYVTGGELFNQIAQHGKLKEDD

superfamily: SSF56112
IPR011009
10-259 Protein kinase-like (PK-like)
Protein kinase-like domain

TRLGKYELGRVIGEGSFAKVRLAKNVETGQNFAIKVLNKERILKDKMVEQIKREISTMKLVKHPNIVQLFEVMASKTKIYFVLEYVTGGELFNQIAQHGKLKEDDARKYFQQLVNAVDYCHSRGVYHRDLKPENLLLDSKGNLKISDFGLSALSQQVKEDGLLHTTCGTPNYVAPEVIVDKGYDGAKADLWSCGVILFVLMAGFLPFDEPNIIALYKKIYRADFTCPKWFSPGARKLFLRILEPKFKYRI

HMMPfam: PF00069
IPR017442
15-258 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YELGRVIGEGSFAKVRLAKNVETGQNFAIKVLNKERILKDKMVEQIKREISTMKLVKHPNIVQLFEVMASKTKIYFVLEYVTGGELFNQIAQHGKLKEDDARKYFQQLVNAVDYCHSRGVYHRDLKPENLLLDSKGNLKISDFGLSALSQQVKEDGLLHTTCGTPNYVAPEVIVDKGYDGAKADLWSCGVILFVLMAGFLPFDEPNIIALYKKIYRADFTCPKWFSPGARKLFLRILEPKFKYR

ProfileScan: PS50011
IPR000719
15-259 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YELGRVIGEGSFAKVRLAKNVETGQNFAIKVLNKERILKDKMVEQIKREISTMKLVKHPNIVQLFEVMASKTKIYFVLEYVTGGELFNQIAQHGKLKEDDARKYFQQLVNAVDYCHSRGVYHRDLKPENLLLDSKGNLKISDFGLSALSQQVKEDGLLHTTCGTPNYVAPEVIVDKGYDGAKADLWSCGVILFVLMAGFLPFDEPNIIALYKKIYRADFTCPKWFSPGARKLFLRILEPKFKYRI

HMMSmart: SM00219
IPR020635
15-255 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YELGRVIGEGSFAKVRLAKNVETGQNFAIKVLNKERILKDKMVEQIKREISTMKLVKHPNIVQLFEVMASKTKIYFVLEYVTGGELFNQIAQHGKLKEDDARKYFQQLVNAVDYCHSRGVYHRDLKPENLLLDSKGNLKISDFGLSALSQQVKEDGLLHTTCGTPNYVAPEVIVDKGYDGAKADLWSCGVILFVLMAGFLPFDEPNIIALYKKIYRADFTCPKWFSPGARKLFLRILEPKF

HMMSmart: SM00220
IPR002290
15-256 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YELGRVIGEGSFAKVRLAKNVETGQNFAIKVLNKERILKDKMVEQIKREISTMKLVKHPNIVQLFEVMASKTKIYFVLEYVTGGELFNQIAQHGKLKEDDARKYFQQLVNAVDYCHSRGVYHRDLKPENLLLDSKGNLKISDFGLSALSQQVKEDGLLHTTCGTPNYVAPEVIVDKGYDGAKADLWSCGVILFVLMAGFLPFDEPNIIALYKKIYRADFTCPKWFSPGARKLFLRILEPKFK

PatternScan: PS00107
IPR017441
21-53 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGSFAKVRLAKNVETGQNFAIKVLNKERILK

Gene3D: G3DSA:1.10.510.10
115-259 no description

ARKYFQQLVNAVDYCHSRGVYHRDLKPENLLLDSKGNLKISDFGLSALSQQVKEDGLLHTTCGTPNYVAPEVIVDKGYDGAKADLWSCGVILFVLMAGFLPFDEPNIIALYKKIYRADFTCPKWFSPGARKLFLRILEPKFKYRI

PatternScan: PS00108
IPR008271
134-146 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VYHRDLKPENLLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox