PRGDB00073848 (Pgl.22750)

From PRG Wiki
Jump to: navigation, search
Pgl.22750
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 83403575 (DV997552)
Gene Class Unknown
Domain Type
Gene Species Picea glauca

Comment?

GQ02739.B3_G07 GQ027: Mature Somatic EMBRYOS Picea glauca cDNA clone GenomeQuebec_Id:GQ02739_G07 5', mRNA sequence

DNA Sequence

CGAAGATGAACATTGATCCTCTTTTTAGTCAACAAGAAAACCTCCCTCAGGTGTACTGCGTCACAGGAGGAGGAGGATACATCGGATCGTGGCTAGTAAAGACTCTGCTGGAGAATGGCTACACAGTGCATGCGACTCTCAGAGATCCAGGGAACCCATTAAAAAATTCATGCCTTCTCTCACTCCCAGGAGCCCAAGAGAGGCTTCGTCTTTTCAGAGCAGATCTGCGCGAGGAAGGGAGCTTCGATTCTGCCATCCATGGTTGCCACGGCGTCTTTCATGTTGCCACTCCCATGGAGTTTGGTTCCAAGGATCCCCAGAATGATATAGTCGATGCTGCAATCCAAGGAACTCTGAACGTTCTGAAATCGTGTAAGAAAGCAGAAAGCGTGAGGCGGGTCGTGTTCACTTCGTCTTTCAGTGCAGCTATCCCGTTCGACAAGTCCCTTATCGATGAATCGTGCTGGACTTCACTGGATATCATCAGGAAAATCAATGACCATGGTCGGTTCTACGCGGAGTCGAAAACACTTGCAGAGAAAGCTGCGTTGCAGTTTGGAAAGGAAAACCCGTCTATTACAGTGGTGAGCATTGTGCTGCCTATTGTCGCGGGTACTTCCATAACCAACACAGCCCCCTTCGGCCTGCATATGGTGTTGTCTTTAATAACAGGCAATCCACAATTGTATGGAGCATTACTGCAACTCAAGGATGGCTTTCTAGGTGATTCTGTCTCGCTCATCCATGTTCAAGATGTCTGCAATGCTCATGTATTTCTGATGGAGCACCCAACTGCGGAAGGACGTTATATTTGTTNTNGGAATTCCACTACCATTCCNNNNNTCGCACATCTCATCTCTNNNNNCTATCNNCAGTACACAnnnnnnnnnnnnnTGGA


Protein sequences

Name Description Sequence
Pgl.22750 translated coding region predicted by ESTScan from UniGene Pgl.22750

XKMNIDPLFSQQENLPQVYCVTGGGGYIGSWLVKTLLENGYTVHATLRDPGNPLKNSCLLSLPGAQERLRLFRADLREEGSFDSAIHGCHGVFHVATPMEFGSKDPQNDIVDAAIQGTLNVLKSCKKAESVRRVVFTSSFSAAIPFDKSLIDESCWTSLDIIRKINDHGRFYAESKTLAEKAALQFGKENPSITVVSIVLPIVAGTSITNTAPFGLHMVLSLITGNPQLYGALLQLKDGFLGDSVSLIHVQDVCNAHVFLMEHPTAEGRYICXXNSTTIPXXAHLISXXYXQYTXXXXXX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366:SF9
5-290 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

IDPLFSQQENLPQVYCVTGGGGYIGSWLVKTLLENGYTVHATLRDPGNPLKNSCLLSLPGAQERLRLFRADLREEGSFDSAIHGCHGVFHVATPMEFGSKDPQNDIVDAAIQGTLNVLKSCKKAESVRRVVFTSSFSAAIPFDKSLIDESCWTSLDIIRKINDHGRFYAESKTLAEKAALQFGKENPSITVVSIVLPIVAGTSITNTAPFGLHMVLSLITGNPQLYGALLQLKDGFLGDSVSLIHVQDVCNAHVFLMEHPTAEGRYICXXNSTTIPXXAHLISXXY

HMMPanther: PTHR10366
5-290 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

IDPLFSQQENLPQVYCVTGGGGYIGSWLVKTLLENGYTVHATLRDPGNPLKNSCLLSLPGAQERLRLFRADLREEGSFDSAIHGCHGVFHVATPMEFGSKDPQNDIVDAAIQGTLNVLKSCKKAESVRRVVFTSSFSAAIPFDKSLIDESCWTSLDIIRKINDHGRFYAESKTLAEKAALQFGKENPSITVVSIVLPIVAGTSITNTAPFGLHMVLSLITGNPQLYGALLQLKDGFLGDSVSLIHVQDVCNAHVFLMEHPTAEGRYICXXNSTTIPXXAHLISXXY

superfamily: SSF51735
17-275 NAD(P)-binding Rossmann-fold domains

QVYCVTGGGGYIGSWLVKTLLENGYTVHATLRDPGNPLKNSCLLSLPGAQERLRLFRADLREEGSFDSAIHGCHGVFHVATPMEFGSKDPQNDIVDAAIQGTLNVLKSCKKAESVRRVVFTSSFSAAIPFDKSLIDESCWTSLDIIRKINDHGRFYAESKTLAEKAALQFGKENPSITVVSIVLPIVAGTSITNTAPFGLHMVLSLITGNPQLYGALLQLKDGFLGDSVSLIHVQDVCNAHVFLMEHPTAEGRYICXXN

Gene3D: G3DSA:3.40.50.720
IPR016040
18-230 no description
NAD(P)-binding domain

VYCVTGGGGYIGSWLVKTLLENGYTVHATLRDPGNPLKNSCLLSLPGAQERLRLFRADLREEGSFDSAIHGCHGVFHVATPMEFGSKDPQNDIVDAAIQGTLNVLKSCKKAESVRRVVFTSSFSAAIPFDKSLIDESCWTSLDIIRKINDHGRFYAESKTLAEKAALQFGKENPSITVVSIVLPIVAGTSITNTAPFGLHMVLSLITGNPQLY

HMMPfam: PF01370
IPR001509
20-269 Epimerase
NAD-dependent epimerase/dehydratase

CVTGGGGYIGSWLVKTLLENGYTVHATLRDPGNPLKNSCLLSLPGAQERLRLFRADLREEGSFDSAIHGCHGVFHVATPMEFGSKDPQNDIVDAAIQGTLNVLKSCKKAESVRRVVFTSSFSAAIPFDKSLIDESCWTSLDIIRKINDHGRFYAESKTLAEKAALQFGKENPSITVVSIVLPIVAGTSITNTAPFGLHMVLSLITGNPQLYGALLQLKDGFLGDSVSLIHVQDVCNAHVFLMEHPTAEGR

Seg: seg
130-141 seg

SVRRVVFTSSFS

Seg: seg
294-300 seg

TXXXXXX






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox