PRGDB00073851 (Pgl.22791)

From PRG Wiki
Jump to: navigation, search
Pgl.22791
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157561437 (EX362668)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Picea glauca

Comment?

GQ03206.B7_B07 GQ032 - Shoot tip (Normalized library) Picea glauca cDNA clone GQ03206_B07 5', mRNA sequence

DNA Sequence

AGAAGTGGATTGTGAATGGGCTGACTTTTGATCGCCATTAAAGGCTTTGTTTGAATGCTTGATAACCATGTTGAGACGAAGGACAGGGTACTCTGATTGAGAAAGAACAAAACTATGCATTGTTGGCAGGGGCTAATGGGAAACTGCTGGACCGGAGAGCAGTGCTCTTTGAGCAAAGTCTCCACCAATAACAAATCTTCCCACCCGCCATCCCCATCAACAACCCACAAGCCAACTCCCACAGACAGCAATGGAGGAAATTCAATTAATCAGTTATCAGCTCCACATGAGGTCGAAGACCTGAGACAAAACTCTGGTTCCAATGTGTATGTTTTCACATTTAATGAGCTCAAGACAATTACCAAAAACTTTAGGGTGGATTATGTATTGGGGGAAGGAGGGTTTGGTACAGTTTACAAGGGTCACATTGACGAGGACATGAAGCCGGGCCTCAATGCCCAGCCAGTTGCTGTCAAGGTCCTTGATCCAGAAGGTCACCAGGGGCACAGAGAATGGCTGGCAGAGGTAATCTTTCTAGGGCAGCTGAGTCATCCTCATTTGGTGAAACTCATTGGATACTGTTGCGAAGATGAGCACAGGCTACTGGTTTACGAGTTCATGGCTCGTGGAAGTCTGGAAAATCATCTATTCCGAAAGATGTCTGTTCCCCTGCCTTGGTCAATAAGAATGAAGATTGCACTCGGGGCTGCCAAAGGGCTAGCTTTTCTTCATGTGGCAGAAAAGCCTGTTATCTATCGTGATTTCAAGACGTCCAATATACTACTGGACACAGACTATACAGCAAAGCTTTCAGACTTTGGACTTGCAAAAGGGGGACCAGAAGGTGACCAGACTCATGTTTCCACTCGCGTGATGGGTACATATGGATATGCAGCTCCAGAGTATGTCATGACTGGTCATTTGACAGCTCGAAGTGATGTCTACAGCTTT


Protein sequences

Name Description Sequence
Pgl.22791 translated coding region predicted by ESTScan from UniGene Pgl.22791

MGNCWTGEQCSLSKVSTNNKSSHPPSPSTTHKPTPTDSNGGNSINQLSAPHEVEDLRQNSGSNVYVFTFNELKTITKNFRVDYVLGEGGFGTVYKGHIDEDMKPGLNAQPVAVKVLDPEGHQGHREWLAEVIFLGQLSHPHLVKLIGYCCEDEHRLLVYEFMARGSLENHLFRKMSVPLPWSIRMKIALGAAKGLAFLHVAEKPVIYRDFKTSNILLDTDYTAKLSDFGLAKGGPEGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSF

Domains

Domain Start-End Description Sequence

Seg: seg
16-36 seg

STNNKSSHPPSPSTTHKPTPT

HMMPanther: PTHR24420:SF881
48-272 SUBFAMILY NOT NAMED

SAPHEVEDLRQNSGSNVYVFTFNELKTITKNFRVDYVLGEGGFGTVYKGHIDEDMKPGLNAQPVAVKVLDPEGHQGHREWLAEVIFLGQLSHPHLVKLIGYCCEDEHRLLVYEFMARGSLENHLFRKMSVPLPWSIRMKIALGAAKGLAFLHVAEKPVIYRDFKTSNILLDTDYTAKLSDFGLAKGGPEGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSF

HMMPanther: PTHR24420
48-272 FAMILY NOT NAMED,FAMILY NOT NAMED

SAPHEVEDLRQNSGSNVYVFTFNELKTITKNFRVDYVLGEGGFGTVYKGHIDEDMKPGLNAQPVAVKVLDPEGHQGHREWLAEVIFLGQLSHPHLVKLIGYCCEDEHRLLVYEFMARGSLENHLFRKMSVPLPWSIRMKIALGAAKGLAFLHVAEKPVIYRDFKTSNILLDTDYTAKLSDFGLAKGGPEGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSF

superfamily: SSF56112
IPR011009
51-272 Protein kinase-like (PK-like)
Protein kinase-like domain

HEVEDLRQNSGSNVYVFTFNELKTITKNFRVDYVLGEGGFGTVYKGHIDEDMKPGLNAQPVAVKVLDPEGHQGHREWLAEVIFLGQLSHPHLVKLIGYCCEDEHRLLVYEFMARGSLENHLFRKMSVPLPWSIRMKIALGAAKGLAFLHVAEKPVIYRDFKTSNILLDTDYTAKLSDFGLAKGGPEGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSF

Gene3D: G3DSA:3.30.200.20
60-148 no description

SGSNVYVFTFNELKTITKNFRVDYVLGEGGFGTVYKGHIDEDMKPGLNAQPVAVKVLDPEGHQGHREWLAEVIFLGQLSHPHLVKLIGY

ProfileScan: PS50011
IPR000719
79-272 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRVDYVLGEGGFGTVYKGHIDEDMKPGLNAQPVAVKVLDPEGHQGHREWLAEVIFLGQLSHPHLVKLIGYCCEDEHRLLVYEFMARGSLENHLFRKMSVPLPWSIRMKIALGAAKGLAFLHVAEKPVIYRDFKTSNILLDTDYTAKLSDFGLAKGGPEGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSF

HMMSmart: SM00220
IPR002290
79-272 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FRVDYVLGEGGFGTVYKGHIDEDMKPGLNAQPVAVKVLDPEGHQGHREWLAEVIFLGQLSHPHLVKLIGYCCEDEHRLLVYEFMARGSLENHLFRKMSVPLPWSIRMKIALGAAKGLAFLHVAEKPVIYRDFKTSNILLDTDYTAKLSDFGLAKGGPEGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSF

HMMSmart: SM00219
IPR020635
79-272 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FRVDYVLGEGGFGTVYKGHIDEDMKPGLNAQPVAVKVLDPEGHQGHREWLAEVIFLGQLSHPHLVKLIGYCCEDEHRLLVYEFMARGSLENHLFRKMSVPLPWSIRMKIALGAAKGLAFLHVAEKPVIYRDFKTSNILLDTDYTAKLSDFGLAKGGPEGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSF

HMMPfam: PF07714
IPR001245
82-272 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

DYVLGEGGFGTVYKGHIDEDMKPGLNAQPVAVKVLDPEGHQGHREWLAEVIFLGQLSHPHLVKLIGYCCEDEHRLLVYEFMARGSLENHLFRKMSVPLPWSIRMKIALGAAKGLAFLHVAEKPVIYRDFKTSNILLDTDYTAKLSDFGLAKGGPEGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSF

PatternScan: PS00107
IPR017441
85-114 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGTVYKGHIDEDMKPGLNAQPVAVK

Gene3D: G3DSA:1.10.510.10
149-272 no description

CCEDEHRLLVYEFMARGSLENHLFRKMSVPLPWSIRMKIALGAAKGLAFLHVAEKPVIYRDFKTSNILLDTDYTAKLSDFGLAKGGPEGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSF

PatternScan: PS00108
IPR008271
205-217 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIYRDFKTSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox