PRGDB00073852 (Pgl.22833)

From PRG Wiki
Jump to: navigation, search
Pgl.22833
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157631543 (EX432625)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Picea glauca

Comment?

GQ03911.B7_C02 GQ039 - Stem - Dormant Picea glauca cDNA clone GQ03911_C02 5', mRNA sequence

DNA Sequence

TGGTGTTGTTGACTTTTATGCGTGTATTTTCTCTAGAAGCTCACGGCTATCCCTAGCCTTTCTGTCTCTCTGGATTCGATCTTAGATCCTCCGTCCTCTTCACGGATCTTACAAGGCTTCAGCAGTCCCAGCCACCATTTCTGCTTCCTACATACCCCCTTGTTTTGCTGTCAATTTGGTGAAATTTTCAGACCCGAGTTCCATATATCCACTTTCCTCTGGTCAATCTTCTCATTCATTGTTCCCCCATGGGCAACTGCTGGGGCACTCGTGTGAAGGCCGAGGTTCCATTGAACAGCAATTCCCCTGGTTCTGGAAACTCAAAGTCTCCTCATGGCTCTGACCATCATATGCTATCTTCCGTTGACAGCTACCCATCTTCTAGGACCGAGGACCAGATTCTGTTGTCATCCAAAATCAAAAGTTTCAGCTTCACAGAGCTCAAGAATGCAACCAGGAATTTTAGACCAGACAGTGTTTTGGGAGAAGGGGGCTTTGGCTGTGTTTTCAAGGGTTGGATTGATGAACATACATTCGCTGCAACGAAGCCGGGGTTGGGTATGGTTATTGCTGTCAAGAAGTTGAATCAGGATGGTTTGCAAGGTCACAAGGAATGGCTGGCCGAGGTAAATTATCTGGGGCAGCTTCACCACCCCAATCTTGTGAAGCTAGTAGGATATTGCGTTGAGGACGATCAGCGCCTACTGGTGTATGAGTTTATGCCTAAAGGGAGCTTGGAGAATCACCTTTTCAGAAGAAGTCATCACTACCGACCTCTTTCTTGGGCTCTTAGGATCAAAGTAGCCATTGGGGCTGCCAAGGGACTTGCTTTTCTTCATGATACAGAAAGTAAAGTTATATATCGAGATTTCA


Protein sequences

Name Description Sequence
Pgl.22833 translated coding region predicted by ESTScan from UniGene Pgl.22833

MGNCWGTRVKAEVPLNSNSPGSGNSKSPHGSDHHMLSSVDSYPSSRTEDQILLSSKIKSFSFTELKNATRNFRPDSVLGEGGFGCVFKGWIDEHTFAATKPGLGMVIAVKKLNQDGLQGHKEWLAEVNYLGQLHHPNLVKLVGYCVEDDQRLLVYEFMPKGSLENHLFRRSHHYRPLSWALRIKVAIGAAKGLAFLHDTESKVIYRDFX

Domains

Domain Start-End Description Sequence

Seg: seg
14-31 seg

PLNSNSPGSGNSKSPHGS

HMMPanther: PTHR24420:SF861
43-208 SUBFAMILY NOT NAMED

PSSRTEDQILLSSKIKSFSFTELKNATRNFRPDSVLGEGGFGCVFKGWIDEHTFAATKPGLGMVIAVKKLNQDGLQGHKEWLAEVNYLGQLHHPNLVKLVGYCVEDDQRLLVYEFMPKGSLENHLFRRSHHYRPLSWALRIKVAIGAAKGLAFLHDTESKVIYRDF

HMMPanther: PTHR24420
43-208 FAMILY NOT NAMED,FAMILY NOT NAMED

PSSRTEDQILLSSKIKSFSFTELKNATRNFRPDSVLGEGGFGCVFKGWIDEHTFAATKPGLGMVIAVKKLNQDGLQGHKEWLAEVNYLGQLHHPNLVKLVGYCVEDDQRLLVYEFMPKGSLENHLFRRSHHYRPLSWALRIKVAIGAAKGLAFLHDTESKVIYRDF

superfamily: SSF56112
IPR011009
44-207 Protein kinase-like (PK-like)
Protein kinase-like domain

SSRTEDQILLSSKIKSFSFTELKNATRNFRPDSVLGEGGFGCVFKGWIDEHTFAATKPGLGMVIAVKKLNQDGLQGHKEWLAEVNYLGQLHHPNLVKLVGYCVEDDQRLLVYEFMPKGSLENHLFRRSHHYRPLSWALRIKVAIGAAKGLAFLHDTESKVIYRD

Gene3D: G3DSA:3.30.200.20
52-144 no description

LLSSKIKSFSFTELKNATRNFRPDSVLGEGGFGCVFKGWIDEHTFAATKPGLGMVIAVKKLNQDGLQGHKEWLAEVNYLGQLHHPNLVKLVGY

ProfileScan: PS50011
IPR000719
72-209 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRPDSVLGEGGFGCVFKGWIDEHTFAATKPGLGMVIAVKKLNQDGLQGHKEWLAEVNYLGQLHHPNLVKLVGYCVEDDQRLLVYEFMPKGSLENHLFRRSHHYRPLSWALRIKVAIGAAKGLAFLHDTESKVIYRDFX

HMMSmart: SM00219
IPR020635
72-208 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FRPDSVLGEGGFGCVFKGWIDEHTFAATKPGLGMVIAVKKLNQDGLQGHKEWLAEVNYLGQLHHPNLVKLVGYCVEDDQRLLVYEFMPKGSLENHLFRRSHHYRPLSWALRIKVAIGAAKGLAFLHDTESKVIYRDF

HMMPfam: PF07714
IPR001245
76-207 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SVLGEGGFGCVFKGWIDEHTFAATKPGLGMVIAVKKLNQDGLQGHKEWLAEVNYLGQLHHPNLVKLVGYCVEDDQRLLVYEFMPKGSLENHLFRRSHHYRPLSWALRIKVAIGAAKGLAFLHDTESKVIYRD

PatternScan: PS00107
IPR017441
78-111 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGCVFKGWIDEHTFAATKPGLGMVIAVKK

Gene3D: G3DSA:1.10.510.10
145-207 no description

CVEDDQRLLVYEFMPKGSLENHLFRRSHHYRPLSWALRIKVAIGAAKGLAFLHDTESKVIYRD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox