PRGDB00073854 (Pgl.22850)

From PRG Wiki
Jump to: navigation, search
Pgl.22850
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157507998 (EX309229)
Gene Class Unknown
Domain Type
Gene Species Picea glauca

Comment?

GQ01310.T3_G07 GQ013 - Elongating ROOTS tips - sapplings Picea glauca cDNA clone GQ01310_G07 3', mRNA sequence

DNA Sequence

TTTTTTAATAATACAATAGTACTTTATTAATCGCCATCCTTTTCTATACACTCGCCTCCCTAACGATGCTGTTCATTGGCGAATGAATCTCTGAACTGCCAAAACCCATCTACCTAGAACCACGTCTATCACCTCCTGCCTGTGCTCTGCTTTACTTCTTACATGCCTCCAACGACTCCTTCAATGCGGCAAGCGCCTTCTCAATATGACCTAACTCCCCGTTCGTAACTGACACACCCATATGACCAAACCGGAAGTATTTGGTCGCGATCTCTTTGTGCAGACCACCGGCAAAGATAACACCCTTCGAAAGCAACTTGGGCAGCAATTCGGGGGCGGTCACGCCCTCAGGCAGGAACGCAGCCGTCATACCATTTGCCTGGCAAGCCTCTTCTGACGTAAGCTGCTTCAGCCCCATCTCGGCCAGCGAGTTCTTGACGTAACGTGAGACCTCGCGGTGCTTGGCGAATCTCTGTTCCATAGGCACGGAGGTAATCTGTATCAAAGAGGTGTGGAGGGCGTGAATAAGTTGTGGGCTGGGGGTGGCAAAGTAGGAGGGCTTTTTGGCTTCGTAGTTTCTCATGATGGGAAGCCAATTGGCGAAGCTGGCAAAGTAGCTTCCAGGCTTGCATTTCCGGGCTTCAAAGGTCTGGATTGATCGACCGCTCATTATCATGATGCACAAACCAGCTGGTACACCGATAGCCTTCTGGGAGGCAGTAAGAACGACATCGATACCCCAATCATCAAACCGGATCTCTTCACAGCCAACTGAACACACACCATCGACAACAACTAGAGTATTGGGGGAAACGCGATACGTAAGCTCGG


Protein sequences

Name Description Sequence
Pgl.22850 translated coding region predicted by ESTScan from UniGene Pgl.22850

XELTYRVSPNTLVVVDGVCSVGCEEIRFDDWGIDVVLTASQKAIGVPAGLCIMIMSGRSIQTFEARKCKPGSYFASFANWLPIMRNYEAKKPSYFATPSPQLIHALHTSLIQITSVPMEQRFAKHREVSRYVKNSLAEMGLKQLTSEEACQANGMTAAFLPEGVTAPELLPKLLSKGVIFAGGLHKEIATKYFRFGHMGVSVTNGELGHIEKALAALKESLEACKK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152:SF7
2-225 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

ELTYRVSPNTLVVVDGVCSVGCEEIRFDDWGIDVVLTASQKAIGVPAGLCIMIMSGRSIQTFEARKCKPGSYFASFANWLPIMRNYEAKKPSYFATPSPQLIHALHTSLIQITSVPMEQRFAKHREVSRYVKNSLAEMGLKQLTSEEACQANGMTAAFLPEGVTAPELLPKLLSKGVIFAGGLHKEIATKYFRFGHMGVSVTNGELGHIEKALAALKESLEACK

HMMPanther: PTHR21152
2-225 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

ELTYRVSPNTLVVVDGVCSVGCEEIRFDDWGIDVVLTASQKAIGVPAGLCIMIMSGRSIQTFEARKCKPGSYFASFANWLPIMRNYEAKKPSYFATPSPQLIHALHTSLIQITSVPMEQRFAKHREVSRYVKNSLAEMGLKQLTSEEACQANGMTAAFLPEGVTAPELLPKLLSKGVIFAGGLHKEIATKYFRFGHMGVSVTNGELGHIEKALAALKESLEACK

superfamily: SSF53383
IPR015424
7-225 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

VSPNTLVVVDGVCSVGCEEIRFDDWGIDVVLTASQKAIGVPAGLCIMIMSGRSIQTFEARKCKPGSYFASFANWLPIMRNYEAKKPSYFATPSPQLIHALHTSLIQITSVPMEQRFAKHREVSRYVKNSLAEMGLKQLTSEEACQANGMTAAFLPEGVTAPELLPKLLSKGVIFAGGLHKEIATKYFRFGHMGVSVTNGELGHIEKALAALKESLEACK

Gene3D: G3DSA:3.40.640.10
IPR015421
10-102 no description
Pyridoxal phosphate-dependent transferase, major r

NTLVVVDGVCSVGCEEIRFDDWGIDVVLTASQKAIGVPAGLCIMIMSGRSIQTFEARKCKPGSYFASFANWLPIMRNYEAKKPSYFATPSPQL

HMMPfam: PF00266
IPR000192
10-185 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

NTLVVVDGVCSVGCEEIRFDDWGIDVVLTASQKAIGVPAGLCIMIMSGRSIQTFEARKCKPGSYFASFANWLPIMRNYEAKKPSYFATPSPQLIHALHTSLIQITSVPMEQRFAKHREVSRYVKNSLAEMGLKQLTSEEACQANGMTAAFLPEGVTAPELLPKLLSKGVIFAGGLH

Gene3D: G3DSA:3.90.1150.10
IPR015422
103-225 no description
Pyridoxal phosphate-dependent transferase, major r

IHALHTSLIQITSVPMEQRFAKHREVSRYVKNSLAEMGLKQLTSEEACQANGMTAAFLPEGVTAPELLPKLLSKGVIFAGGLHKEIATKYFRFGHMGVSVTNGELGHIEKALAALKESLEACK

Seg: seg
211-226 seg

EKALAALKESLEACKK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox