PRGDB00073859 (Pgl.23112)

From PRG Wiki
Jump to: navigation, search
Pgl.23112
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157514682 (EX315913)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Picea glauca

Comment?

GQ02809.B7_P01 GQ028 - Cambium

DNA Sequence

TTGCATGGAATGATCCAGGGGACATGCAGGAAGGCATTTTATGCAGATGTAAATTATGTATATATCAATGTTATCTCCATTCCAATACCCATTGAAGTCATTGTAAGTTCTGCTACTTGGATTATCTTCAAGGCttttgtttttttGGGATTTCTGCAATATTTCAGAAGGTTGTGTGTGCTGATCTGCTTGCTAGTTTCTCCACATTTTCTGTTTGTTTTTCATGAAACTCTTTGCAGTAGATGGGTTTGAGAAATATCCAGCTTTCGTATAATGTATATGTCATTTATTGTGGCCACTGATATGGCCTGAAGCTTCAAAAAGTTTAAAACAATGGCAGAAAACTTTAAACTTGGGTTGCCAAGTATCATTGCCATAGCAGTCTCTGGAGGGGTGGTTTCCATCCTCATACTTACGGTTCTGATCGTTTATCTCCTGAGATATACTGGTGGGAGGAAGAAGAAATCACTCAAATCGGAGGAAGATGGAGAGAAGGAGCAGAAGCTTGTAATGTTTTACAGCCCAATAAATTATCAAAATGTATTAGAGGCCACTGGGCAGTTTGATGAAGAGCATGTATTGAGCAGAACGAGGTATGGAGTTGTGTTCAAGGCTTGTTTTGAAGACGGAACGGTGCTTTCCATAAGGAGATTGCCTGAAGGGCAAATATTGGAAGAAAGCGCTTTTAAGAAAGAGGCAGAAGCTCTTGGAAGAGTTAAGCACTCAAATTTGACTGCATTGAGAGGGTATTATGCCAGTGGTGATGTAAGACTGTTGGTGTATGACTACATGCCTAATGGAAACCTGGCTACTCTCCTGCAAGAGGCCGCACATCAAGATGGGCACATCCTTAATTGGCCTATGAGGCACCTCATTGCCCTTGGGCTCGCTCG


Protein sequences

Name Description Sequence
Pgl.23112 translated coding region predicted by ESTScan from UniGene Pgl.23112

MAENFKLGLPSIIAIAVSGGVVSILILTVLIVYLLRYTGGRKKKSLKSEEDGEKEQKLVMFYSPINYQNVLEATGQFDEEHVLSRTRYGVVFKACFEDGTVLSIRRLPEGQILEESAFKKEAEALGRVKHSNLTALRGYYASGDVRLLVYDYMPNGNLATLLQEAAHQDGHILNWPMRHLIALGLAR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF687
12-187 SUBFAMILY NOT NAMED

IIAIAVSGGVVSILILTVLIVYLLRYTGGRKKKSLKSEEDGEKEQKLVMFYSPINYQNVLEATGQFDEEHVLSRTRYGVVFKACFEDGTVLSIRRLPEGQILEESAFKKEAEALGRVKHSNLTALRGYYASGDVRLLVYDYMPNGNLATLLQEAAHQDGHILNWPMRHLIALGLAR

HMMPanther: PTHR24420
12-187 FAMILY NOT NAMED,FAMILY NOT NAMED

IIAIAVSGGVVSILILTVLIVYLLRYTGGRKKKSLKSEEDGEKEQKLVMFYSPINYQNVLEATGQFDEEHVLSRTRYGVVFKACFEDGTVLSIRRLPEGQILEESAFKKEAEALGRVKHSNLTALRGYYASGDVRLLVYDYMPNGNLATLLQEAAHQDGHILNWPMRHLIALGLAR

Seg: seg
21-35 seg

VVSILILTVLIVYLL

superfamily: SSF56112
IPR011009
49-187 Protein kinase-like (PK-like)
Protein kinase-like domain

EEDGEKEQKLVMFYSPINYQNVLEATGQFDEEHVLSRTRYGVVFKACFEDGTVLSIRRLPEGQILEESAFKKEAEALGRVKHSNLTALRGYYASGDVRLLVYDYMPNGNLATLLQEAAHQDGHILNWPMRHLIALGLAR

Gene3D: G3DSA:3.30.200.20
69-165 no description

NVLEATGQFDEEHVLSRTRYGVVFKACFEDGTVLSIRRLPEGQILEESAFKKEAEALGRVKHSNLTALRGYYASGDVRLLVYDYMPNGNLATLLQEA

ProfileScan: PS50011
IPR000719
77-187 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDEEHVLSRTRYGVVFKACFEDGTVLSIRRLPEGQILEESAFKKEAEALGRVKHSNLTALRGYYASGDVRLLVYDYMPNGNLATLLQEAAHQDGHILNWPMRHLIALGLAR

HMMPfam: PF07714
IPR001245
81-165 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

HVLSRTRYGVVFKACFEDGTVLSIRRLPEGQILEESAFKKEAEALGRVKHSNLTALRGYYASGDVRLLVYDYMPNGNLATLLQEA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox