PRGDB00073861 (Pgl.23254)

From PRG Wiki
Jump to: navigation, search
Pgl.23254
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225918435 (GO371842)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Picea glauca

Comment?

GQ04109.B7.r_G20 GQ041 - Shoot tip - Dormant (Normalized) Picea glauca cDNA clone GQ04109_G20 5', mRNA sequence

DNA Sequence

ATACAAAGCGGAGATGCCAGGAGGGGATGCCATAGCCGTCAAGAAGCTGCAGTTGAATCAGAAATTAAATCAAAATACCCTCGAAGAACTAGATGCTTTGGGCAATGTAAGGCACAGAAATATACTCAGGCTGCTCGGCTTCTGTTACAACAACGAGAATTCTCTCATTTTTCTGTACGAGTTCATGCCCAACGGTAGCCTGGCCGGCGAATATCATAACAAGAAAGAATTCGGCTGGGCGACGAGATATCAAATCGCGGAGGGACTCGCACATGCGCTCTGCTATCTTCACCATGACTGCAATCCAGCAACTGTGCACGGCGCCCTGGAGCCCAGCAACGTACTGCTAGACAGTCACATGGAGACCCGGCTTTCTGATTTCTGCATGGCCAAGCTTCCGGACGACGCCATGTGCTCCACTGCCTATATCTCCCCAGAACATGAACCTTCAAGGGACGAGAAGTCCGACATCTACAGCTTTGGAGTGATTCTTCTGGAGCTCCTGACAGGCATGAGCGCAGTCGACTCAGAAGGGGTCAGCATTGTCGATTTCGTTCGAGGAAAATGCACCGAGATTCGGAGGACGGAAGGCTCTTTGATGGACATTTTAGACAAAAACATGAACAAGCAGTCGGCGGTGAAGGAAAATCAGGCGATGCTGATGCTCCATGTGGCCCTGCTCTGCACCAACAGGCGCCCGTTCGATCGGCCATCCATGAGAGATGTAGTGAGCATGCTCTCTGAGAAAACGCCGCTGAGGAAAACAGTTATGGATTTTCACTGTACATTGACCCAAGGAAGCACGTCGGCGTTCCCAATGTGAAGAACGAATCTCTCAGTGGCAGTGGAGAGTCATGGAACACGTACAGTATACTTTACAGGTGCTGTAACATGGGTT


Protein sequences

Name Description Sequence
Pgl.23254 translated coding region predicted by ESTScan from UniGene Pgl.23254

XYKAEMPGGDAIAVKKLQLNQKLNQNTLEELDALGNVRHRNILRLLGFCYNNENSLIFLYEFMPNGSLAGEYHNKKEFGWATRYQIAEGLAHALCYLHHDCNPATVHGALEPSNVLLDSHMETRLSDFCMAKLPDDAMCSTAYISPEHEPSRDEKSDIYSFGVILLELLTGMSAVDSEGVSIVDFVRGKCTEIRRTEGSLMDILDKNMNKQSAVKENQAMLMLHVALLCTNRRPFDRPSMRDVVSMLSEKTPLRKTVMDFHCTLTQGSTSAFPMXRTNLSVAVESHGTRTVYFTGAVTWV

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-254 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XYKAEMPGGDAIAVKKLQLNQKLNQNTLEELDALGNVRHRNILRLLGFCYNNENSLIFLYEFMPNGSLAGEYHNKKEFGWATRYQIAEGLAHALCYLHHDCNPATVHGALEPSNVLLDSHMETRLSDFCMAKLPDDAMCSTAYISPEHEPSRDEKSDIYSFGVILLELLTGMSAVDSEGVSIVDFVRGKCTEIRRTEGSLMDILDKNMNKQSAVKENQAMLMLHVALLCTNRRPFDRPSMRDVVSMLSEKTPLR

superfamily: SSF56112
IPR011009
2-247 Protein kinase-like (PK-like)
Protein kinase-like domain

YKAEMPGGDAIAVKKLQLNQKLNQNTLEELDALGNVRHRNILRLLGFCYNNENSLIFLYEFMPNGSLAGEYHNKKEFGWATRYQIAEGLAHALCYLHHDCNPATVHGALEPSNVLLDSHMETRLSDFCMAKLPDDAMCSTAYISPEHEPSRDEKSDIYSFGVILLELLTGMSAVDSEGVSIVDFVRGKCTEIRRTEGSLMDILDKNMNKQSAVKENQAMLMLHVALLCTNRRPFDRPSMRDVVSML

Gene3D: G3DSA:3.30.200.20
2-48 no description

YKAEMPGGDAIAVKKLQLNQKLNQNTLEELDALGNVRHRNILRLLGF

HMMPanther: PTHR24420:SF883
2-255 SUBFAMILY NOT NAMED

YKAEMPGGDAIAVKKLQLNQKLNQNTLEELDALGNVRHRNILRLLGFCYNNENSLIFLYEFMPNGSLAGEYHNKKEFGWATRYQIAEGLAHALCYLHHDCNPATVHGALEPSNVLLDSHMETRLSDFCMAKLPDDAMCSTAYISPEHEPSRDEKSDIYSFGVILLELLTGMSAVDSEGVSIVDFVRGKCTEIRRTEGSLMDILDKNMNKQSAVKENQAMLMLHVALLCTNRRPFDRPSMRDVVSMLSEKTPLRK

HMMPanther: PTHR24420
2-255 FAMILY NOT NAMED,FAMILY NOT NAMED

YKAEMPGGDAIAVKKLQLNQKLNQNTLEELDALGNVRHRNILRLLGFCYNNENSLIFLYEFMPNGSLAGEYHNKKEFGWATRYQIAEGLAHALCYLHHDCNPATVHGALEPSNVLLDSHMETRLSDFCMAKLPDDAMCSTAYISPEHEPSRDEKSDIYSFGVILLELLTGMSAVDSEGVSIVDFVRGKCTEIRRTEGSLMDILDKNMNKQSAVKENQAMLMLHVALLCTNRRPFDRPSMRDVVSMLSEKTPLRK

HMMSmart: SM00220
IPR002290
2-247 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YKAEMPGGDAIAVKKLQLNQKLNQNTLEELDALGNVRHRNILRLLGFCYNNENSLIFLYEFMPNGSLAGEYHNKKEFGWATRYQIAEGLAHALCYLHHDCNPATVHGALEPSNVLLDSHMETRLSDFCMAKLPDDAMCSTAYISPEHEPSRDEKSDIYSFGVILLELLTGMSAVDSEGVSIVDFVRGKCTEIRRTEGSLMDILDKNMNKQSAVKENQAMLMLHVALLCTNRRPFDRPSMRDVVSML

HMMSmart: SM00219
IPR020635
2-247 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YKAEMPGGDAIAVKKLQLNQKLNQNTLEELDALGNVRHRNILRLLGFCYNNENSLIFLYEFMPNGSLAGEYHNKKEFGWATRYQIAEGLAHALCYLHHDCNPATVHGALEPSNVLLDSHMETRLSDFCMAKLPDDAMCSTAYISPEHEPSRDEKSDIYSFGVILLELLTGMSAVDSEGVSIVDFVRGKCTEIRRTEGSLMDILDKNMNKQSAVKENQAMLMLHVALLCTNRRPFDRPSMRDVVSML

HMMPfam: PF00069
IPR017442
9-244 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

GDAIAVKKLQLNQKLNQNTLEELDALGNVRHRNILRLLGFCYNNENSLIFLYEFMPNGSLAGEYHNKKEFGWATRYQIAEGLAHALCYLHHDCNPATVHGALEPSNVLLDSHMETRLSDFCMAKLPDDAMCSTAYISPEHEPSRDEKSDIYSFGVILLELLTGMSAVDSEGVSIVDFVRGKCTEIRRTEGSLMDILDKNMNKQSAVKENQAMLMLHVALLCTNRRPFDRPSMRDVV

Seg: seg
15-26 seg

KKLQLNQKLNQN

Gene3D: G3DSA:1.10.510.10
49-247 no description

CYNNENSLIFLYEFMPNGSLAGEYHNKKEFGWATRYQIAEGLAHALCYLHHDCNPATVHGALEPSNVLLDSHMETRLSDFCMAKLPDDAMCSTAYISPEHEPSRDEKSDIYSFGVILLELLTGMSAVDSEGVSIVDFVRGKCTEIRRTEGSLMDILDKNMNKQSAVKENQAMLMLHVALLCTNRRPFDRPSMRDVVSML






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox