PRGDB00073862 (Pgl.23317)

From PRG Wiki
Jump to: navigation, search
Pgl.23317
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157607976 (EX409200)
Gene Class Unknown
Domain Type
Gene Species Picea glauca

Comment?

GQ03604.B7_G19 GQ036 - Shoot tip - Active growth Picea glauca cDNA clone GQ03604_G19 5', mRNA sequence

DNA Sequence

AGAAGGCTTGATATGCTAGTTGATCCTGATCTTAAGAACAATTATGTTGAAGCAGAGGTGGAACAACTTATTCAAGTTGCATTACTTTGTACACAAGGGTCACCAATGGATAGACCAAAGATGTCTGAAGTGGTACGGATGTTGGAAGGGGATGGCTTAGCCGAGAGATGGGAGGAGTGGCAAAAGGTGGAAGTTGTGCGGAGCCAGGAAGTTGAACTTGTTCCTCACAGAAATTCAGAATGGATTGTTGACTCAACAGATAATCTTCATGCAGTTGAATTGTCTGGTCCGAGATGATAAGAGTCGAACTGTTTATTCAATCTTTGAAAAGCCAAAATTTTATTGAGTCCAAATTACAATGTCAATATGTATCAAGGTTGAATCGGTGTATCATTTTCAAGCATTTTAGTAGATGCTTCAATGTGCCAATGTAGAGAATATTCGTTGCAAGTCTTTAGATGGCTATGCTGGGTTTTGTCCCATGAGGATTTCTGACGGGTTACAGTCAAACCTGCAAGTTAGAAGGATTTCTCATGGTGCATCCCATCCAGGCAACGATCCGGGCTCTGTATTATGAATGGTTTGCTCTAGGAATCAAAGCTCCATTTCTGCTATTGAAGACTTCCTTTTTCAGTGCTAATATGTATTTAAACAGTCTGTCCACTTGACATATGCAACTACTTTTCCTGCCGAGAGTGTACTTTGATAAGACCACAATGTTTTGAGACTAGTGCTAAATTGGGTCTCTAACCCGGAGTGGAGATTGAAGGACAAAGAATTTCATGGGTACCAAGCTTCTCCTAAATCCCTTGAGCTGGGCTCTTAAATTCTCGATAATCCTCCAGAGTTTGAGAAAGATGGATGTTGTCAAAGGTAGATCCCAAGCTAGTGGACT


Protein sequences

Name Description Sequence
Pgl.23317 translated coding region predicted by ESTScan from UniGene Pgl.23317

RRLDMLVDPDLKNNYVEAEVEQLIQVALLCTQGSPMDRPKMSEVVRMLEGDGLAERWEEWQKVEVVRSQEVELVPHRNSEWIVDSTDNLHAVELSGPR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF351
1-89 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

RRLDMLVDPDLKNNYVEAEVEQLIQVALLCTQGSPMDRPKMSEVVRMLEGDGLAERWEEWQKVEVVRSQEVELVPHRNSEWIVDSTDNL

HMMPanther: PTHR24420
1-89 FAMILY NOT NAMED,FAMILY NOT NAMED

RRLDMLVDPDLKNNYVEAEVEQLIQVALLCTQGSPMDRPKMSEVVRMLEGDGLAERWEEWQKVEVVRSQEVELVPHRNSEWIVDSTDNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox