PRGDB00073863 (Pgl.23463)

From PRG Wiki
Jump to: navigation, search
Pgl.23463
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225919942 (GO368028)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Picea glauca

Comment?

GQ03807.B7P2_P11 GQ038 - Stem - Active growth Picea glauca cDNA clone GQ03807_P11 5', mRNA sequence

DNA Sequence

CGTTTTCAGATCTGTCAGCGCTTCCAGTTCCAGGTTCAGGGAGCTAGAGGATTCAATGTGGCGGAATTTAAGCCTTCCTCCAGGCTATGTATACATTTGCTGCCTTCGTTTTGACGATAACAACTACCTCAATGTCCAATTGCAACTTTTCCCTATGGAGGGCAAGTATTTTAATCGAAAAGAAATTCAGAGGATTAGTTTCGCTCTGAGCAAGCAAACGTACAAACCGCCCCACGAATTCGGACCCTTTTTCTTCCTGGCAGACCTATACATTTTTCCTGATAACAGCAGATCGAGCAGTTTGAGCTCAGCTGTAATTATTGGCATAGCCACTGGTGCAGCACTTTTGGCACTTGCCATTCTTGGTGTTAGTTTTTACGCATTAAGGCAGAAACAAAGAGCTGATCAGGCGATCGAATTAAGCAAACCCTTCGTTTCTTGGGGAGCAAGCGGTCCGGATAGTGGTGGCGCTCCCAAACTCAAAGGGGCCAGATGGTTTTCATGTCAAGAGCTTAAGAAGTCCACCAATAACTTCTCGGATGCTCATGAAATTGGTTCAGGAGGCTACGGAAAGGTGTATAAGGGAATCTTGCCCGTTGCAGGTGAAATGGTAGCTATTAAAAGAGCGCAGCAAGGGTCTCTCCAAGGTGGTGCTGAATTTAAGAACGAGATCGAGCTGTTGTCTCGGGTTCATCACAAGAACCTCGTGGGACTCATTGGTTTCTGTTTTGAGCAAGGAGAGCAGATGCTAGTTTACGAATACATGTCGAATGGTAGTCTTAAGGATAGTCTTTCTGGTAAAAGTGGTATTCATTTGGATTGGCGGGAGGAGGGTTCGCATCGCATTGGGTTCAGCCAAGGGCTTAAGCTATCTGCATGAGCTTGCCTATCCGCCTATAATTCACAGAGATGTTAAGTCAACCAA


Protein sequences

Name Description Sequence
Pgl.23463 translated coding region predicted by ESTScan from UniGene Pgl.23463

XVFRSVSASSSRFRELEDSMWRNLSLPPGYVYICCLRFDDNNYLNVQLQLFPMEGKYFNRKEIQRISFALSKQTYKPPHEFGPFFFLADLYIFPDNSRSSSLSSAVIIGIATGAALLALAILGVSFYALRQKQRADQAIELSKPFVSWGASGPDSGGAPKLKGARWFSCQELKKSTNNFSDAHEIGSGGYGKVYKGILPVAGEMVAIKRAQQGSLQGGAEFKNEIELLSRVHHKNLVGLIGFCFEQGEQMLVYEYMSNGSLKDSLSGKSGIHLDWREEGSHRIGFSQGLKLSAELAYPPIIHRDVKSTX

Domains

Domain Start-End Description Sequence

Seg: seg
1-14 seg

XVFRSVSASSSRFR

HMMPanther: PTHR24420:SF476
73-308 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

QTYKPPHEFGPFFFLADLYIFPDNSRSSSLSSAVIIGIATGAALLALAILGVSFYALRQKQRADQAIELSKPFVSWGASGPDSGGAPKLKGARWFSCQELKKSTNNFSDAHEIGSGGYGKVYKGILPVAGEMVAIKRAQQGSLQGGAEFKNEIELLSRVHHKNLVGLIGFCFEQGEQMLVYEYMSNGSLKDSLSGKSGIHLDWREEGSHRIGFSQGLKLSAELAYPPIIHRDVKST

HMMPanther: PTHR24420
73-308 FAMILY NOT NAMED,FAMILY NOT NAMED

QTYKPPHEFGPFFFLADLYIFPDNSRSSSLSSAVIIGIATGAALLALAILGVSFYALRQKQRADQAIELSKPFVSWGASGPDSGGAPKLKGARWFSCQELKKSTNNFSDAHEIGSGGYGKVYKGILPVAGEMVAIKRAQQGSLQGGAEFKNEIELLSRVHHKNLVGLIGFCFEQGEQMLVYEYMSNGSLKDSLSGKSGIHLDWREEGSHRIGFSQGLKLSAELAYPPIIHRDVKST

Seg: seg
97-104 seg

SRSSSLSS

Seg: seg
107-123 seg

IIGIATGAALLALAILG

superfamily: SSF56112
IPR011009
151-307 Protein kinase-like (PK-like)
Protein kinase-like domain

SGPDSGGAPKLKGARWFSCQELKKSTNNFSDAHEIGSGGYGKVYKGILPVAGEMVAIKRAQQGSLQGGAEFKNEIELLSRVHHKNLVGLIGFCFEQGEQMLVYEYMSNGSLKDSLSGKSGIHLDWREEGSHRIGFSQGLKLSAELAYPPIIHRDVKS

Gene3D: G3DSA:3.30.200.20
162-241 no description

KGARWFSCQELKKSTNNFSDAHEIGSGGYGKVYKGILPVAGEMVAIKRAQQGSLQGGAEFKNEIELLSRVHHKNLVGLIG

ProfileScan: PS50011
IPR000719
179-309 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSDAHEIGSGGYGKVYKGILPVAGEMVAIKRAQQGSLQGGAEFKNEIELLSRVHHKNLVGLIGFCFEQGEQMLVYEYMSNGSLKDSLSGKSGIHLDWREEGSHRIGFSQGLKLSAELAYPPIIHRDVKSTX

HMMSmart: SM00219
IPR020635
179-305 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSDAHEIGSGGYGKVYKGILPVAGEMVAIKRAQQGSLQGGAEFKNEIELLSRVHHKNLVGLIGFCFEQGEQMLVYEYMSNGSLKDSLSGKSGIHLDWREEGSHRIGFSQGLKLSAELAYPPIIHRDV

HMMPfam: PF07714
IPR001245
183-306 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

HEIGSGGYGKVYKGILPVAGEMVAIKRAQQGSLQGGAEFKNEIELLSRVHHKNLVGLIGFCFEQGEQMLVYEYMSNGSLKDSLSGKSGIHLDWREEGSHRIGFSQGLKLSAELAYPPIIHRDVK

PatternScan: PS00107
IPR017441
185-208 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGSGGYGKVYKGILPVAGEMVAIK

Gene3D: G3DSA:1.10.510.10
242-307 no description

FCFEQGEQMLVYEYMSNGSLKDSLSGKSGIHLDWREEGSHRIGFSQGLKLSAELAYPPIIHRDVKS

Seg: seg
257-270 seg

SNGSLKDSLSGKSG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox