PRGDB00073864 (Pgl.23577)

From PRG Wiki
Jump to: navigation, search
Pgl.23577
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157527077 (EX328308)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Picea glauca

Comment?

GQ02828.B7_N19 GQ028 - Cambium

DNA Sequence

TATTATGGGAAGTATTGTAGCTTTATTTTTTGTGCTTGCTGCCATTATGACCATCTTCAAACGCAGAACCAATGCTGCCATAATAATTCCTTGGAAGAAATTATTGAGTGGCCATGAACAAAAGGCATTGATCACAGATGTTGGAGCAGTCAACGGCGTTCCCGTGATGAGTCGAGCAGAGCTTGAAACAGCGTGTGAAGATTTCAGCAACGTTATTGGCTCATCTCCTGATAGTATGGTCTATAAAGGTATAATATCTCAGGGAACAGAAATTGCCGTAACAAGCATGCGCTTTGCCAGAGAAGATTGGACCACCCATTTAGAGATTTATTTCCAAAGAAAGGTGGCAGACCTGGCAAAGTTGAATCACAGAAACATTGTCAAATTGTTGGGATATTGCGCAGAAAATGAGCCATTCACAAGAATGCTCGTGTTTGAATATGCTTCAAATGGGACACTGTACGAGCATCTTCATTATGGCGAGCCAGGGCAGTTAAGCTGGTCTGCACGAATGAAAATTATACTAGGAGTGGCGCATGGTTTACAGTATATGCACCATGAACTCATACCTCCTGTTGCTATTATGGACTTGGACTCCAATGCAGTGTACCTGACAGAAGACTTCTCGCCGAAGTTGGCAGACTTTGAGATATGGAAAACCATATTTGCAAAGAATGAACGGAGGTCAATCTTCAGGGGTACTGCAACTGTGGCTCGTGATTCTGTAGAATCTTCGGAGAGAGATGCAACAGATATTGAATTGAACTTGTTTAGCTTTGGAGTGCTGCTACTGGAGATTATCACTGGGCGATTTCCATATTCCAAGGACCAGGGATCCTTGCTTGACTGGGCACAAGAATATCTGGAGGTCCCTGAAGTCATTTCCTACTTGGTTG


Protein sequences

Name Description Sequence
Pgl.23577 translated coding region predicted by ESTScan from UniGene Pgl.23577

XIMGSIVALFFVLAAIMTIFKRRTNAAIIIPWKKLLSGHEQKALITDVGAVNGVPVMSRAELETACEDFSNVIGSSPDSMVYKGIISQGTEIAVTSMRFAREDWTTHLEIYFQRKVADLAKLNHRNIVKLLGYCAENEPFTRMLVFEYASNGTLYEHLHYGEPGQLSWSARMKIILGVAHGLQYMHHELIPPVAIMDLDSNAVYLTEDFSPKLADFEIWKTIFAKNERRSIFRGTATVARDSVESSERDATDIELNLFSFGVLLLEIITGRFPYSKDQGSLLDWAQEYLEVPEVISYLVX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF812
2-299 LEUCINE-RICH REPEAT TRANSMEMBRANE PROTEIN KINASE, PUTATIVE

IMGSIVALFFVLAAIMTIFKRRTNAAIIIPWKKLLSGHEQKALITDVGAVNGVPVMSRAELETACEDFSNVIGSSPDSMVYKGIISQGTEIAVTSMRFAREDWTTHLEIYFQRKVADLAKLNHRNIVKLLGYCAENEPFTRMLVFEYASNGTLYEHLHYGEPGQLSWSARMKIILGVAHGLQYMHHELIPPVAIMDLDSNAVYLTEDFSPKLADFEIWKTIFAKNERRSIFRGTATVARDSVESSERDATDIELNLFSFGVLLLEIITGRFPYSKDQGSLLDWAQEYLEVPEVISYLV

HMMPanther: PTHR24420
2-299 FAMILY NOT NAMED,FAMILY NOT NAMED

IMGSIVALFFVLAAIMTIFKRRTNAAIIIPWKKLLSGHEQKALITDVGAVNGVPVMSRAELETACEDFSNVIGSSPDSMVYKGIISQGTEIAVTSMRFAREDWTTHLEIYFQRKVADLAKLNHRNIVKLLGYCAENEPFTRMLVFEYASNGTLYEHLHYGEPGQLSWSARMKIILGVAHGLQYMHHELIPPVAIMDLDSNAVYLTEDFSPKLADFEIWKTIFAKNERRSIFRGTATVARDSVESSERDATDIELNLFSFGVLLLEIITGRFPYSKDQGSLLDWAQEYLEVPEVISYLV

superfamily: SSF56112
IPR011009
39-274 Protein kinase-like (PK-like)
Protein kinase-like domain

HEQKALITDVGAVNGVPVMSRAELETACEDFSNVIGSSPDSMVYKGIISQGTEIAVTSMRFAREDWTTHLEIYFQRKVADLAKLNHRNIVKLLGYCAENEPFTRMLVFEYASNGTLYEHLHYGEPGQLSWSARMKIILGVAHGLQYMHHELIPPVAIMDLDSNAVYLTEDFSPKLADFEIWKTIFAKNERRSIFRGTATVARDSVESSERDATDIELNLFSFGVLLLEIITGRFPY

Gene3D: G3DSA:3.30.200.20
53-133 no description

GVPVMSRAELETACEDFSNVIGSSPDSMVYKGIISQGTEIAVTSMRFAREDWTTHLEIYFQRKVADLAKLNHRNIVKLLGY

ProfileScan: PS50011
IPR000719
67-300 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

EDFSNVIGSSPDSMVYKGIISQGTEIAVTSMRFAREDWTTHLEIYFQRKVADLAKLNHRNIVKLLGYCAENEPFTRMLVFEYASNGTLYEHLHYGEPGQLSWSARMKIILGVAHGLQYMHHELIPPVAIMDLDSNAVYLTEDFSPKLADFEIWKTIFAKNERRSIFRGTATVARDSVESSERDATDIELNLFSFGVLLLEIITGRFPYSKDQGSLLDWAQEYLEVPEVISYLVX

HMMSmart: SM00220
IPR002290
67-298 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

EDFSNVIGSSPDSMVYKGIISQGTEIAVTSMRFAREDWTTHLEIYFQRKVADLAKLNHRNIVKLLGYCAENEPFTRMLVFEYASNGTLYEHLHYGEPGQLSWSARMKIILGVAHGLQYMHHELIPPVAIMDLDSNAVYLTEDFSPKLADFEIWKTIFAKNERRSIFRGTATVARDSVESSERDATDIELNLFSFGVLLLEIITGRFPYSKDQGSLLDWAQEYLEVPEVISYL

HMMSmart: SM00219
IPR020635
67-298 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

EDFSNVIGSSPDSMVYKGIISQGTEIAVTSMRFAREDWTTHLEIYFQRKVADLAKLNHRNIVKLLGYCAENEPFTRMLVFEYASNGTLYEHLHYGEPGQLSWSARMKIILGVAHGLQYMHHELIPPVAIMDLDSNAVYLTEDFSPKLADFEIWKTIFAKNERRSIFRGTATVARDSVESSERDATDIELNLFSFGVLLLEIITGRFPYSKDQGSLLDWAQEYLEVPEVISYL

HMMPfam: PF07714
IPR001245
70-276 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SNVIGSSPDSMVYKGIISQGTEIAVTSMRFAREDWTTHLEIYFQRKVADLAKLNHRNIVKLLGYCAENEPFTRMLVFEYASNGTLYEHLHYGEPGQLSWSARMKIILGVAHGLQYMHHELIPPVAIMDLDSNAVYLTEDFSPKLADFEIWKTIFAKNERRSIFRGTATVARDSVESSERDATDIELNLFSFGVLLLEIITGRFPYSK

Gene3D: G3DSA:1.10.510.10
134-278 no description

CAENEPFTRMLVFEYASNGTLYEHLHYGEPGQLSWSARMKIILGVAHGLQYMHHELIPPVAIMDLDSNAVYLTEDFSPKLADFEIWKTIFAKNERRSIFRGTATVARDSVESSERDATDIELNLFSFGVLLLEIITGRFPYSKDQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox