PRGDB00073880 (Pgl.24290)

From PRG Wiki
Jump to: navigation, search
Pgl.24290
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157561548 (EX362779)
Gene Class Unknown
Domain Type
Gene Species Picea glauca

Comment?

GQ03206.B7_G02 GQ032 - Shoot tip (Normalized library) Picea glauca cDNA clone GQ03206_G02 5', mRNA sequence

DNA Sequence

AGGTCCAGCAGACTAACTTTACCTTTCTCTGAGTCACTTCCTTTCAGAGGAAGAACAGGATGGAGAAAGATCATATACGTCTGGCTGTTGGAATCATTGGAAACGTTACCTCTTTACTTCTGTATGGAGCACCTGTGCTCACATTCATGAAAGTGATAAAAGAGAAATCTGTGGGGCAGTACTCGTGCACCCCATACCTAATTGCTCTCTTCAACTGTTTAATCTATACATGGTATGGGTTCCCTGTGGTCAGTAATGGTTGGGAGAACTTCCTGGTTTCCACTGTTAATGGCGTTGGAATTGTTCCAGAGTGTTTCGCCATTTGCACTTATATTGTTTATGCTCCACCCAAGTTTAAGCGAAAGGTGGCAAGGATGGTTGGGTGTGTCCTGGTGTTGTTCGGTGTAATGGCAGCAATATCTTTCTTTTCTCTTCACGACCATAAGAATCGCAAATTCATGATAGGAATAGTGGGAATACTGTCGTCCATTTCTTTGTACAGTGCTCCATTTGTTGCCATGAAGCTGGTGATTCAAACAAAAAGTGTGGAGTTCATGCCTTTCTACTTGTCATTTTTTGCTTTTATCAACTGCATTATGTGGATGACCTATGGTGCTCTGAGCCGAGATATCTTCCTTGCGACCCCAAACGTGATCGGTTCTCCATTGGCATTGGCTCAGCTAGTGTTGTACTGCATATATAGAAAGAAAACAAGAGGTGTACAGAACAATCTGGATCCAGAGGAAGGAGTGCAAATTAATGGAGCTCAGAGCACAAACTCTGAAGAGAAGACCAAGTTACCAGACGGCCAAAAGGGGGAGAATGCAGAATACATTAACGCCACAGAAATGAAGACCATCCTGATCAACTGATAAATTTTAGTCAGCAGGATTCAGAAACAGTACTATTTTTC


Protein sequences

Name Description Sequence
Pgl.24290 translated coding region predicted by ESTScan from UniGene Pgl.24290

MEKDHIRLAVGIIGNVTSLLLYGAPVLTFMKVIKEKSVGQYSCTPYLIALFNCLIYTWYGFPVVSNGWENFLVSTVNGVGIVPECFAICTYIVYAPPKFKRKVARMVGCVLVLFGVMAAISFFSLHDHKNRKFMIGIVGILSSISLYSAPFVAMKLVIQTKSVEFMPFYLSFFAFINCIMWMTYGALSRDIFLATPNVIGSPLALAQLVLYCIYRKKTRGVQNNLDPEEGVQINGAQSTNSEEKTKLPDGQKGENAEYINATEMKTILIN


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10791
IPR004316
10-231 RAG1-ACTIVATING PROTEIN 1
RAG1-activating protein-1-related

VGIIGNVTSLLLYGAPVLTFMKVIKEKSVGQYSCTPYLIALFNCLIYTWYGFPVVSNGWENFLVSTVNGVGIVPECFAICTYIVYAPPKFKRKVARMVGCVLVLFGVMAAISFFSLHDHKNRKFMIGIVGILSSISLYSAPFVAMKLVIQTKSVEFMPFYLSFFAFINCIMWMTYGALSRDIFLATPNVIGSPLALAQLVLYCIYRKKTRGVQNNLDPEEGV

HMMPfam: PF03083
IPR004316
10-97 MtN3_slv
RAG1-activating protein-1-related

VGIIGNVTSLLLYGAPVLTFMKVIKEKSVGQYSCTPYLIALFNCLIYTWYGFPVVSNGWENFLVSTVNGVGIVPECFAICTYIVYAPP

HMMPfam: PF03083
IPR004316
134-218 MtN3_slv
RAG1-activating protein-1-related

MIGIVGILSSISLYSAPFVAMKLVIQTKSVEFMPFYLSFFAFINCIMWMTYGALSRDIFLATPNVIGSPLALAQLVLYCIYRKKT

Seg: seg
135-148 seg

IGIVGILSSISLYS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox