PRGDB00073881 (Pgl.24315)

From PRG Wiki
Jump to: navigation, search
Pgl.24315
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157562416 (EX363647)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Picea glauca

Comment?

GQ03207.B7_M17 GQ032 - Shoot tip (Normalized library) Picea glauca cDNA clone GQ03207_M17 5', mRNA sequence

DNA Sequence

CAAGAGATCAACGCCGCCACCGATAATTTCAGTGAAGCAAATCTCATCGGACAAGGGGCTTTCGCTACGGTGTACAGGGGAACTTTTCCGGACGGTCGGCGGATCGCGGTGAAGAGATTCAGAAACTGCACTCCGGAAGGCGATTCCGAATTCGTGAACGAAGTGGAGGTCATCAAAAACATTAGGCACCGGAATCTAGTCGTTTTGAGAGGCTGCTGCGTGACCAGCGACGACAGTGAGGGGCATCAGCGGTTTCTGATATACGATTGCATGCCCAATGGCAGTCTGCATGAACATCTCTTTGGAGGAAAGTCCGAGGCCCAACCTTTGAGCTGGTCGCAGAGAAGGAACATCGTCCTCGGCACTGCCAAAGGGCTGGCTTATCTGCACGACGGTATCGAGCCGGCCATTTACCACAGAGACATCAAACCCACTAACATTCTGCTGGATGAAGAAATGAATGCCTGCGTGGCCGATTTTGGTCTGGCAAGGATCATGACCAAAGAAGGAGACTCCCATCTGACGACGAGGATAGCAGGGACGCACGGCTACTTGGCCCCCGAATACGCTCTCTATGGGCAACTCACAGACAAGAGCGATGTCTATAGCTTCGGCGTTGTGTTATTGGAGATCATGAGCGGCAGAAAGGCTCTGGACACCTCTGCGGATTCGACCTCTCCCTATCTGATCACGGATTGGGCATGGAAACTGGTGAAAGAAGGCAGAACCAGTGAAATAATAGACATGAGAATCCGGCAGAGCGGACCAGAGAACGTCATGAAAAGGTTTGTTTTAGTGGGTATTCTGTGCGCACATATGATGGTGGCATTCAGACCTCGAATGGTGGAGGCTGTGAAGATGTTGGAAGGAGAAGTGGAGATCC


Protein sequences

Name Description Sequence
Pgl.24315 translated coding region predicted by ESTScan from UniGene Pgl.24315

QEINAATDNFSEANLIGQGAFATVYRGTFPDGRRIAVKRFRNCTPEGDSEFVNEVEVIKNIRHRNLVVLRGCCVTSDDSEGHQRFLIYDCMPNGSLHEHLFGGKSEAQPLSWSQRRNIVLGTAKGLAYLHDGIEPAIYHRDIKPTNILLDEEMNACVADFGLARIMTKEGDSHLTTRIAGTHGYLAPEYALYGQLTDKSDVYSFGVVLLEIMSGRKALDTSADSTSPYLITDWAWKLVKEGRTSEIIDMRIRQSGPENVMKRFVLVGILCAHMMVAFRPRMVEAVKMLEGEVEIX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF420
1-294 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

QEINAATDNFSEANLIGQGAFATVYRGTFPDGRRIAVKRFRNCTPEGDSEFVNEVEVIKNIRHRNLVVLRGCCVTSDDSEGHQRFLIYDCMPNGSLHEHLFGGKSEAQPLSWSQRRNIVLGTAKGLAYLHDGIEPAIYHRDIKPTNILLDEEMNACVADFGLARIMTKEGDSHLTTRIAGTHGYLAPEYALYGQLTDKSDVYSFGVVLLEIMSGRKALDTSADSTSPYLITDWAWKLVKEGRTSEIIDMRIRQSGPENVMKRFVLVGILCAHMMVAFRPRMVEAVKMLEGEVEI

HMMPanther: PTHR24420
1-294 FAMILY NOT NAMED,FAMILY NOT NAMED

QEINAATDNFSEANLIGQGAFATVYRGTFPDGRRIAVKRFRNCTPEGDSEFVNEVEVIKNIRHRNLVVLRGCCVTSDDSEGHQRFLIYDCMPNGSLHEHLFGGKSEAQPLSWSQRRNIVLGTAKGLAYLHDGIEPAIYHRDIKPTNILLDEEMNACVADFGLARIMTKEGDSHLTTRIAGTHGYLAPEYALYGQLTDKSDVYSFGVVLLEIMSGRKALDTSADSTSPYLITDWAWKLVKEGRTSEIIDMRIRQSGPENVMKRFVLVGILCAHMMVAFRPRMVEAVKMLEGEVEI

superfamily: SSF56112
IPR011009
1-288 Protein kinase-like (PK-like)
Protein kinase-like domain

QEINAATDNFSEANLIGQGAFATVYRGTFPDGRRIAVKRFRNCTPEGDSEFVNEVEVIKNIRHRNLVVLRGCCVTSDDSEGHQRFLIYDCMPNGSLHEHLFGGKSEAQPLSWSQRRNIVLGTAKGLAYLHDGIEPAIYHRDIKPTNILLDEEMNACVADFGLARIMTKEGDSHLTTRIAGTHGYLAPEYALYGQLTDKSDVYSFGVVLLEIMSGRKALDTSADSTSPYLITDWAWKLVKEGRTSEIIDMRIRQSGPENVMKRFVLVGILCAHMMVAFRPRMVEAVKML

Gene3D: G3DSA:3.30.200.20
2-90 no description

EINAATDNFSEANLIGQGAFATVYRGTFPDGRRIAVKRFRNCTPEGDSEFVNEVEVIKNIRHRNLVVLRGCCVTSDDSEGHQRFLIYDC

ProfileScan: PS50011
IPR000719
10-295 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEANLIGQGAFATVYRGTFPDGRRIAVKRFRNCTPEGDSEFVNEVEVIKNIRHRNLVVLRGCCVTSDDSEGHQRFLIYDCMPNGSLHEHLFGGKSEAQPLSWSQRRNIVLGTAKGLAYLHDGIEPAIYHRDIKPTNILLDEEMNACVADFGLARIMTKEGDSHLTTRIAGTHGYLAPEYALYGQLTDKSDVYSFGVVLLEIMSGRKALDTSADSTSPYLITDWAWKLVKEGRTSEIIDMRIRQSGPENVMKRFVLVGILCAHMMVAFRPRMVEAVKMLEGEVEIX

HMMSmart: SM00220
IPR002290
10-274 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSEANLIGQGAFATVYRGTFPDGRRIAVKRFRNCTPEGDSEFVNEVEVIKNIRHRNLVVLRGCCVTSDDSEGHQRFLIYDCMPNGSLHEHLFGGKSEAQPLSWSQRRNIVLGTAKGLAYLHDGIEPAIYHRDIKPTNILLDEEMNACVADFGLARIMTKEGDSHLTTRIAGTHGYLAPEYALYGQLTDKSDVYSFGVVLLEIMSGRKALDTSADSTSPYLITDWAWKLVKEGRTSEIIDMRIRQSGPENVMKRFVLVGILCAHMM

HMMSmart: SM00219
IPR020635
10-288 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSEANLIGQGAFATVYRGTFPDGRRIAVKRFRNCTPEGDSEFVNEVEVIKNIRHRNLVVLRGCCVTSDDSEGHQRFLIYDCMPNGSLHEHLFGGKSEAQPLSWSQRRNIVLGTAKGLAYLHDGIEPAIYHRDIKPTNILLDEEMNACVADFGLARIMTKEGDSHLTTRIAGTHGYLAPEYALYGQLTDKSDVYSFGVVLLEIMSGRKALDTSADSTSPYLITDWAWKLVKEGRTSEIIDMRIRQSGPENVMKRFVLVGILCAHMMVAFRPRMVEAVKML

HMMPfam: PF00069
IPR017442
13-229 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ANLIGQGAFATVYRGTFPDGRRIAVKRFRNCTPEGDSEFVNEVEVIKNIRHRNLVVLRGCCVTSDDSEGHQRFLIYDCMPNGSLHEHLFGGKSEAQPLSWSQRRNIVLGTAKGLAYLHDGIEPAIYHRDIKPTNILLDEEMNACVADFGLARIMTKEGDSHLTTRIAGTHGYLAPEYALYGQLTDKSDVYSFGVVLLEIMSGRKALDTSADSTSPYL

PatternScan: PS00107
IPR017441
16-38 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGQGAFATVYRGTFPDGRRIAVK

Gene3D: G3DSA:1.10.510.10
91-288 no description

MPNGSLHEHLFGGKSEAQPLSWSQRRNIVLGTAKGLAYLHDGIEPAIYHRDIKPTNILLDEEMNACVADFGLARIMTKEGDSHLTTRIAGTHGYLAPEYALYGQLTDKSDVYSFGVVLLEIMSGRKALDTSADSTSPYLITDWAWKLVKEGRTSEIIDMRIRQSGPENVMKRFVLVGILCAHMMVAFRPRMVEAVKML

PatternScan: PS00108
IPR008271
137-149 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IYHRDIKPTNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox