PRGDB00073884 (Pgl.24445)

From PRG Wiki
Jump to: navigation, search
Pgl.24445
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157567805 (EX369033)
Gene Class Unknown
Domain Type LRR
Gene Species Picea glauca

Comment?

GQ03215.B7_K23 GQ032 - Shoot tip (Normalized library) Picea glauca cDNA clone GQ03215_K23 5', mRNA sequence

DNA Sequence

AAGAACATCGAGTAATTTGGAGGGGTGCCTGCTTCGGCTCCAACACTTGGCACTGCACAACATACAAATATCAGAGGTATCATTTTCCACGGGTGTTTGCCCCAACCTCCAACATCTTGACATCAGGGAATGTAAAGATCTGGTGACGGTTGGAGCATTGCCAAATGCACTTGTAACACTGAAATTGTATGACTGTCCTAAATTGTGGAAAATAAAAGGGTTATGTGGTTTTGCAAAACTTCAGACGCCGGACGTAAGCCGGTCCAAAGAAGTGGAGGAGCCACAGCCGAGACAGCTTCGAGAACTACACGTTTCTTTATGCCATGGGTTAGAAGAGCTGCTAGGCGTTGGACATTTGAAGTCCTTGGAGGTGTTGCAGGCATGTGAGTGTGTCAAGCTGAAGAGCATACAAGGTTTGGAGCAGATGACACAGCTTCAAAAACTAGACGTTTCTTACTGCTTTGAGTTAGAAGAGCTGCCAGGCATTGAACGTTTGAGGTCCTTGATAAAGTTGCAGGCACGTAGTTGTAAGAAGCTGAAGAGCATACAGGTGTCGGCACAGCTGACACAGCTTCGAGAACTAGATGTTTCTTTCTGCTCTGAGTTGGAAGAGATGCCAGGTGTTGGATATTTGGAGTCATTGGTGGTGTTGCGGGCATCTGAATGTGTGAAGCTGACGAGCTTATGGGGTTTGGCACAGCCAACACAGCTTCAAGAACTAGATGTCTCTGGCTGCTCTGAGTTAGAAGAGATGCCAGGCGTTGGATATTTGCAGTCATTGGTGGTGTTGCGGGCATCTGATTGTGTGAAGCTGAAGAGCATACATGGCTCCGCGCAACTTACACAGCTCCTAAAGCTGGACGTTTCTGGATGCC


Protein sequences

Name Description Sequence
Pgl.24445 translated coding region predicted by ESTScan from UniGene Pgl.24445

XRTSSNLEGCLLRLQHLALHNIQISEVSFSTGVCPNLQHLDIRECKDLVTVGALPNALVTLKLYDCPKLWKIKGLCGFAKLQTPDVSRSKEVEEPQPRQLRELHVSLCHGLEELLGVGHLKSLEVLQACECVKLKSIQGLEQMTQLQKLDVSYCFELEELPGIERLRSLIKLQARSCKKLKSIQVSAQLTQLRELDVSFCSELEEMPGVGYLESLVVLRASECVKLTSLWGLAQPTQLQELDVSGCSELEEMPGVGYLQSLVVLRASDCVKLKSIHGSAQLTQLLKLDVSGCX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
9-292 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GCLLRLQHLALHNIQISEVSFSTGVCPNLQHLDIRECKDLVTVGALPNALVTLKLYDCPKLWKIKGLCGFAKLQTPDVSRSKEVEEPQPRQLRELHVSLCHGLEELLGVGHLKSLEVLQACECVKLKSIQGLEQMTQLQKLDVSYCFELEELPGIERLRSLIKLQARSCKKLKSIQVSAQLTQLRELDVSFCSELEEMPGVGYLESLVVLRASECVKLTSLWGLAQPTQLQELDVSGCSELEEMPGVGYLQSLVVLRASDCVKLKSIHGSAQLTQLLKLDVSGC

Gene3D: G3DSA:3.80.10.10
9-111 no description

GCLLRLQHLALHNIQISEVSFSTGVCPNLQHLDIRECKDLVTVGALPNALVTLKLYDCPKLWKIKGLCGFAKLQTPDVSRSKEVEEPQPRQLRELHVSLCHGL

superfamily: SSF52058
11-292 L domain-like,LRR

LLRLQHLALHNIQISEVSFSTGVCPNLQHLDIRECKDLVTVGALPNALVTLKLYDCPKLWKIKGLCGFAKLQTPDVSRSKEVEEPQPRQLRELHVSLCHGLEELLGVGHLKSLEVLQACECVKLKSIQGLEQMTQLQKLDVSYCFELEELPGIERLRSLIKLQARSCKKLKSIQVSAQLTQLRELDVSFCSELEEMPGVGYLESLVVLRASECVKLTSLWGLAQPTQLQELDVSGCSELEEMPGVGYLQSLVVLRASDCVKLKSIHGSAQLTQLLKLDVSGC

HMMPfam: PF13516
34-46 LRR_6,Leucine Rich repeat

CPNLQHLDIRECK

Seg: seg
107-120 seg

LCHGLEELLGVGHL

Gene3D: G3DSA:3.80.10.10
112-292 no description

EELLGVGHLKSLEVLQACECVKLKSIQGLEQMTQLQKLDVSYCFELEELPGIERLRSLIKLQARSCKKLKSIQVSAQLTQLRELDVSFCSELEEMPGVGYLESLVVLRASECVKLTSLWGLAQPTQLQELDVSGCSELEEMPGVGYLQSLVVLRASDCVKLKSIHGSAQLTQLLKLDVSGC

HMMPfam: PF13504
144-161 LRR_7,Leucine rich repeat

TQLQKLDVSYCFELEELP

HMMPfam: PF13504
190-207 LRR_7,Leucine rich repeat

TQLRELDVSFCSELEEMP

HMMPfam: PF13504
236-253 LRR_7,Leucine rich repeat

TQLQELDVSGCSELEEMP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox