PRGDB00073910 (Pgl.25300)

From PRG Wiki
Jump to: navigation, search
Pgl.25300
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157568701 (EX369929)
Gene Class Unknown
Domain Type LRR
Gene Species Picea glauca

Comment?

GQ03218.B7_B23 GQ032 - Shoot tip (Normalized library) Picea glauca cDNA clone GQ03218_B23 5', mRNA sequence

DNA Sequence

ATGGCTGAAGGAGATTGTTTGGAAAGCATATTGAACAGAGTGCAGTCTCCACATCTTGTATGGCTCAGATGGGATAGCTGTCCCTACTCTTGCCTGCCTCGCTGGATCCCAATGGAGAGTCTCAGAGTGTTACAAGTTCAGGGAAGCAGATTGGAGACACTGTGGGAAGAAACTAATTTTCAGGCACCTCTGCAGCTGAGGGAGTTGGATATAAATGCTCGCCTTCTAAAGATCCCGAAGTCCATAGGGAAGCTGAAGCACCTTGAAAAAATTATCTTGCACCGGAATTACGGATATTCCCAGGTTGATCTGAAAACTTTACCAGATGAATTCTGTCATCTTCAGTCCTTGAAACACTTGGAGCTATTAAAGTGTTCCCAAATAAAGTCCCTGCCAAATTCCTTTGGCAAGTTAAGGAACCTCCAACATATTGACTTGTCAGGGTGCTCCAGTTTGGAGATGCTTCCAATTTCCTTTGCAAATTTAGGGCAACTTAAATATCTCTCTTTGAGATCATGCGGAAGGTTGGGCATTTGGAGGGAAATTCTTGGAAATATTAGCACACTCGAATACTTAGATCTCTCTGGTTGTAAGAAAATTGAAGTATTGCCTCCCCAAGTCGCACATCAACCGTTCTTGCGAGAAATGCATGTGTTCGGTACAAGCTTAAAAGAATTACCACATAAGCTTTGCAACCTAACACTTTTACGAGTTCTGCATATTGGAAGCGAATTGTTGGAAATATTGCCAACTTCGCTCGGTGTCCTAAGGAGCTTGGAGGATCTCAGGTTCGAGGGTTGCACCAGACTGAGAAGTTTGCACGATTCCATTGGACTGGTGACTCAGTTGAGAACGTTGAAAATTATGGACTCAGGTGTTGAGTACTTACCACCATCTGTCATGGGCCTGAAACATCTTGAACAGTT


Protein sequences

Name Description Sequence
Pgl.25300 translated coding region predicted by ESTScan from UniGene Pgl.25300

MAEGDCLESILNRVQSPHLVWLRWDSCPYSCLPRWIPMESLRVLQVQGSRLETLWEETNFQAPLQLRELDINARLLKIPKSIGKLKHLEKIILHRNYGYSQVDLKTLPDEFCHLQSLKHLELLKCSQIKSLPNSFGKLRNLQHIDLSGCSSLEMLPISFANLGQLKYLSLRSCGRLGIWREILGNISTLEYLDLSGCKKIEVLPPQVAHQPFLREMHVFGTSLKELPHKLCNLTLLRVLHIGSELLEILPTSLGVLRSLEDLRFEGCTRLRSLHDSIGLVTQLRTLKIMDSGVEYLPPSVMGLKHLEQX


Domains

Domain Start-End Description Sequence

superfamily: SSF52047
17-308 RNI-like,LRR

PHLVWLRWDSCPYSCLPRWIPMESLRVLQVQGSRLETLWEETNFQAPLQLRELDINARLLKIPKSIGKLKHLEKIILHRNYGYSQVDLKTLPDEFCHLQSLKHLELLKCSQIKSLPNSFGKLRNLQHIDLSGCSSLEMLPISFANLGQLKYLSLRSCGRLGIWREILGNISTLEYLDLSGCKKIEVLPPQVAHQPFLREMHVFGTSLKELPHKLCNLTLLRVLHIGSELLEILPTSLGVLRSLEDLRFEGCTRLRSLHDSIGLVTQLRTLKIMDSGVEYLPPSVMGLKHLEQ

Gene3D: G3DSA:3.80.10.10
17-164 no description

PHLVWLRWDSCPYSCLPRWIPMESLRVLQVQGSRLETLWEETNFQAPLQLRELDINARLLKIPKSIGKLKHLEKIILHRNYGYSQVDLKTLPDEFCHLQSLKHLELLKCSQIKSLPNSFGKLRNLQHIDLSGCSSLEMLPISFANLGQ

HMMPanther: PTHR23155
18-290 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

HLVWLRWDSCPYSCLPRWIPMESLRVLQVQGSRLETLWEETNFQAPLQLRELDINARLLKIPKSIGKLKHLEKIILHRNYGYSQVDLKTLPDEFCHLQSLKHLELLKCSQIKSLPNSFGKLRNLQHIDLSGCSSLEMLPISFANLGQLKYLSLRSCGRLGIWREILGNISTLEYLDLSGCKKIEVLPPQVAHQPFLREMHVFGTSLKELPHKLCNLTLLRVLHIGSELLEILPTSLGVLRSLEDLRFEGCTRLRSLHDSIGLVTQLRTLKIMD

HMMPfam: PF13855
116-173 LRR_8,Leucine rich repeat

SLKHLELLKCSQIKSLPNSFGKLRNLQHIDLSGCSSLEMLPISFANLGQLKYLSLRSC

Gene3D: G3DSA:3.80.10.10
165-307 no description

LKYLSLRSCGRLGIWREILGNISTLEYLDLSGCKKIEVLPPQVAHQPFLREMHVFGTSLKELPHKLCNLTLLRVLHIGSELLEILPTSLGVLRSLEDLRFEGCTRLRSLHDSIGLVTQLRTLKIMDSGVEYLPPSVMGLKHLE

HMMPfam: PF00560
IPR001611
189-205 LRR_1
Leucine-rich repeat

LEYLDLSGCKKIEVLPP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox